DDIT4L Antibody - #DF12596
| Product: | DDIT4L Antibody |
| Catalog: | DF12596 |
| Description: | Rabbit polyclonal antibody to DDIT4L |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | Q96D03 |
| RRID: | AB_2845558 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12596, RRID:AB_2845558.
Fold/Unfold
DNA damage inducible transcript 4 like; DNA damage inducible transcript 4 like protein; HIF 1 responsive protein RTP801 like; Homolog of mouse SMHS1; Protein regulated in development and DNA damage response 2; Protein regulated in development and DNA damage responses 2; REDD 2; REDD2; Regulated in development and DNA damage response 2; RTP801L;
Immunogens
Up-regulated in atherosclerotic plaques relative to healthy segments of the same artery.
- Q96D03 DDT4L_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96D03 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K83 | Acetylation | Uniprot | |
| T148 | Phosphorylation | Uniprot | |
| S149 | Phosphorylation | Uniprot |
Research Backgrounds
Inhibits cell growth by regulating the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.
Cytoplasm.
Up-regulated in atherosclerotic plaques relative to healthy segments of the same artery.
Belongs to the DDIT4 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.