SAMSN1 Antibody - #DF12730
| Product: | SAMSN1 Antibody |
| Catalog: | DF12730 |
| Description: | Rabbit polyclonal antibody to SAMSN1 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 42 kDa, 55 kDa; 42kD(Calculated). |
| Uniprot: | Q9NSI8 |
| RRID: | AB_2845691 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12730, RRID:AB_2845691.
Fold/Unfold
HACS1; Hematopoietic adapter containing SH3 and sterile α motif (SAM) domains 1; Hematopoietic adapter containing SH3 and sterile alpha motif (SAM) domains 1; Hematopoietic adaptor containing SH3 and SAM domains 1; Nash1; Nuclear localization signals SAM and SH3 domain containing 1; SAM and SH3 domain containing 2; SAM domain; SAM domain containing protein SAMSN 1; SAM domain SH3 domain and nuclear localisation signals 1; SAM domain SH3 domain and nuclear localization signals 1; SAM domain, SH3 domain and nuclear localization signals protein 1; SAM domain-containing protein SAMSN-1; SAMN1_HUMAN; SAMSN 1; Samsn1; SASH2; SH3 domain and nuclear localisation signals 1; SH3 domain and nuclear localization signals protein 1; SH3 SAM adaptor protein; SH3-SAM adaptor protein; SH3D6B; SLy2; Src homology domain 3 (SH3) containing adapter protein SH3 lymphocyte protein 2;
Immunogens
A synthesized peptide derived from human SAMSN1, corresponding to a region within the internal amino acids.
Detected in peripheral blood B-cells (at protein level). Detected in spleen, liver and peripheral blood.
- Q9NSI8 SAMN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPSD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Negative regulator of B-cell activation. Down-regulates cell proliferation (in vitro). Promotes RAC1-dependent membrane ruffle formation and reorganization of the actin cytoskeleton. Regulates cell spreading and cell polarization. Stimulates HDAC1 activity. Regulates LYN activity by modulating its tyrosine phosphorylation (By similarity).
Nucleus. Cytoplasm. Cell projection>Ruffle.
Note: Shuttles between cytoplasm and nucleus. Colocalizes with the actin cytoskeleton and actin-rich membrane ruffles (By similarity).
Detected in peripheral blood B-cells (at protein level). Detected in spleen, liver and peripheral blood.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.