SEC13 Antibody - #DF12734
| Product: | SEC13 Antibody |
| Catalog: | DF12734 |
| Description: | Rabbit polyclonal antibody to SEC13 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 36 kDa; 36kD(Calculated). |
| Uniprot: | P55735 |
| RRID: | AB_2845695 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12734, RRID:AB_2845695.
Fold/Unfold
D3S1231E; Npp 20; Npp20; Protein SEC13 homolog; SEC13 (S. cerevisiae) like 1; Sec13; SEC13 homolog (S. cerevisiae); SEC13 homolog; SEC13 like 1 (S. cerevisiae); SEC13 like 1 isoform; SEC13 like protein 1; SEC13 protein; SEC13 related protein; SEC13-like protein 1; SEC13-related protein; SEC13_HUMAN; SEC13R;
Immunogens
A synthesized peptide derived from human SEC13, corresponding to a region within the internal amino acids.
- P55735 SEC13_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles. Required for the exit of adipsin (CFD/ADN), an adipocyte-secreted protein from the endoplasmic reticulum (By similarity).
As a component of the GATOR subcomplex GATOR2, functions within the amino acid-sensing branch of the TORC1 signaling pathway. Indirectly activates mTORC1 and the TORC1 signaling pathway through the inhibition of the GATOR1 subcomplex. It is negatively regulated by the upstream amino acid sensors SESN2 and CASTOR1.
Cytoplasmic vesicle>COPII-coated vesicle membrane>Peripheral membrane protein>Cytoplasmic side. Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side. Nucleus>Nuclear pore complex. Lysosome membrane.
Note: In interphase, localizes at both sides of the NPC.
Belongs to the WD repeat SEC13 family.
Research Fields
· Environmental Information Processing > Signal transduction > mTOR signaling pathway. (View pathway)
· Genetic Information Processing > Translation > RNA transport.
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.