SPRR3 Antibody - #DF12751

Product: | SPRR3 Antibody |
Catalog: | DF12751 |
Description: | Rabbit polyclonal antibody to SPRR3 |
Application: | WB IF/ICC |
Cited expt.: | WB |
Reactivity: | Human, Rat |
Mol.Wt.: | 25 kDa; 18kD(Calculated). |
Uniprot: | Q9UBC9 |
RRID: | AB_2845712 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12751, RRID:AB_2845712.
Fold/Unfold
22 kDa pancornulin; Cornifin beta; Esophagin; Small proline rich protein 3; Small proline-rich protein 3; SPRC; Sprr3; SPRR3_HUMAN;
Immunogens
A synthesized peptide derived from human SPRR3, corresponding to a region within the internal amino acids.
- Q9UBC9 SPRR3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
Research Backgrounds
Cross-linked envelope protein of keratinocytes.
Cytoplasm.
Belongs to the cornifin (SPRR) family.
References
Application: WB Species: Human Sample: ccRCC cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.