TMEM11 Antibody - #DF12776
| Product: | TMEM11 Antibody |
| Catalog: | DF12776 |
| Description: | Rabbit polyclonal antibody to TMEM11 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | P17152 |
| RRID: | AB_2845737 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12776, RRID:AB_2845737.
Fold/Unfold
C17orf35; mitochondrial; PM1; PMI; Protein PM1; Protein PMI; Putative receptor protein; tmem11; TMM11_HUMAN; Transmembrane protein 11; Transmembrane protein 11, mitochondrial;
Immunogens
- P17152 TMM11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P17152 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S13 | Phosphorylation | Uniprot | |
| S14 | Phosphorylation | Uniprot | |
| S17 | Phosphorylation | Uniprot | |
| S25 | Phosphorylation | Uniprot | |
| T65 | Phosphorylation | Uniprot | |
| K142 | Ubiquitination | Uniprot | |
| S144 | Phosphorylation | Uniprot | |
| S154 | Phosphorylation | Uniprot | |
| T155 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in mitochondrial morphogenesis.
Mitochondrion inner membrane>Multi-pass membrane protein.
Associates with the mitochondrial contact site and cristae organizing system (MICOS) complex, composed of at least MICOS10/MIC10, CHCHD3/MIC19, CHCHD6/MIC25, APOOL/MIC27, IMMT/MIC60, APOO/MIC23/MIC26 and QIL1/MIC13. This complex was also known under the names MINOS or MitOS complex. The MICOS complex associates with mitochondrial outer membrane proteins SAMM50, MTX1, MTX2 and DNAJC11, mitochondrial inner membrane protein TMEM11 and with HSPA9. Interacts with IMMT/MIC60.
Belongs to the TMEM11 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.