TMEM175 Antibody - #DF12777
Product: | TMEM175 Antibody |
Catalog: | DF12777 |
Description: | Rabbit polyclonal antibody to TMEM175 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse |
Mol.Wt.: | 56 kDa; 56kD(Calculated). |
Uniprot: | Q9BSA9 |
RRID: | AB_2845738 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12777, RRID:AB_2845738.
Fold/Unfold
Hypothetical protein DKFZp547K246; hypothetical protein LOC84286; Hypothetical protein MGC4618; MGC4618; TM175_HUMAN; tmem175; Transmembrane protein 175;
Immunogens
A synthesized peptide derived from human TMEM175, corresponding to a region within the internal amino acids.
- Q9BSA9 TM175_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTITFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRALYRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREPSAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLVAALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQQTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMFAKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLARPEHPPPAPTGQDDPQSQLLPAPC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Organelle-specific potassium channel specifically responsible for potassium conductance in endosomes and lysosomes. Forms a potassium-permeable leak-like channel, which regulates lumenal pH stability and is required for autophagosome-lysosome fusion. Constitutes the major lysosomal potassium channel.
Endosome membrane>Multi-pass membrane protein. Lysosome membrane>Multi-pass membrane protein.
Widely expressed.
Composed of two modules of six transmembranes, forming a homodimer with a tetrameric architecture (PubMed:28723891). The six transmembrane regions of each module are tightly packed within each subunit without undergoing domain swapping (By similarity). Transmembranes TM1-TM3 of each module are positioned on the inner circle of the channel tetramer and participate in inter-subunit interactions that are central to the assembly of the ion conduction pore (By similarity). The RxxxFSD motifs within transmembranes TM1 coordinate a network of specific inter- and intra-subunit interactions with other conserved residues on TM2 and TM3 and play a key role in the tetrameric assembly of the channel (By similarity). Transmembranes TM4-TM6 are positioned on the periphery of the channel and do not contribute contacts with neighboring subunits (By similarity). Transmembranes TM1 and TM2 are linked by an extended strand-like tail and two short helices (H1 and H2) which protrude outwards from the main body of the transmembrane domain and enclose the external open entrance of the ion conduction pore in the channel tetramer (By similarity). Transmembranes TM1 form the pore-lining inner helix at the center of the channel, creating an hourglass-shaped ion permeation pathway in the channel tetramer (By similarity). Three hydrophobic residues on the C-terminal half of the TM1 helices form a bottleneck along the ion conduction pathway and serve as the selectivity filter of the channel (By similarity). Ile-46 (and Ile-271) are probably responsible for channel selectivity (PubMed:28723891).
Belongs to the TMEM175 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.