TXNL6 Antibody - #DF12788
Product: | TXNL6 Antibody |
Catalog: | DF12788 |
Description: | Rabbit polyclonal antibody to TXNL6 |
Application: | WB |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Dog, Xenopus |
Mol.Wt.: | 28 kDa; 24kD(Calculated). |
Uniprot: | Q96CM4 |
RRID: | AB_2845749 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12788, RRID:AB_2845749.
Fold/Unfold
Nucleoredoxin like 1; Nucleoredoxin-like protein 1; Nxnl1; NXNL1_HUMAN; RDCVF; Rod derived cone viability factor; Thioredoxin like 6; Thioredoxin-like protein 6;
Immunogens
A synthesized peptide derived from human TXNL6, corresponding to a region within N-terminal amino acids.
- Q96CM4 NXNL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods.
Cell projection>Cilium>Photoreceptor outer segment.
Belongs to the nucleoredoxin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.