ARD1A Antibody - #DF12828
| Product: | ARD1A Antibody |
| Catalog: | DF12828 |
| Description: | Rabbit polyclonal antibody to ARD1A |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
| Mol.Wt.: | 26 kDa; 26kD(Calculated). |
| Uniprot: | P41227 |
| RRID: | AB_2845789 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12828, RRID:AB_2845789.
Fold/Unfold
Alpha N acetyltransferase 1A; ARD1; ARD1 homolog N acetyltransferase (S. cerevisiae); ARD1 homolog A N acetyltransferase (S. cerevisiae); ARD1 homolog A N acetyltransferase; ARD1A; DXS707; MGC71248; N acetyltransferase ARD1, human homolog of; N alpha acetyltransferase 10 NatA catalytic subunit; N terminal acetyltransferase complex ARD1 subunit homolog A; N(alpha) acetyltransferase 10 NatA catalytic subunit; N-alpha-acetyltransferase 10; N-terminal acetyltransferase complex ARD1 subunit homolog A; Naa10; NAA10_HUMAN; NatA catalytic subunit; TE2;
Immunogens
A synthesized peptide derived from human ARD1A, corresponding to a region within the internal amino acids.
- P41227 NAA10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Catalytic subunit of the N-terminal acetyltransferase A (NatA) complex which displays alpha (N-terminal) acetyltransferase activity. Acetylates amino termini that are devoid of initiator methionine. The alpha (N-terminal) acetyltransferase activity may be important for vascular, hematopoietic and neuronal growth and development. Without NAA15, displays epsilon (internal) acetyltransferase activity towards HIF1A, thereby promoting its degradation. Represses MYLK kinase activity by acetylation, and thus represses tumor cell migration. Acetylates, and stabilizes TSC2, thereby repressing mTOR activity and suppressing cancer development. Acetylates HSPA1A and HSPA1B at 'Lys-77' which enhances its chaperone activity and leads to preferential binding to co-chaperone HOPX. Acetylates HIST1H4A. Acts as a negative regulator of sister chromatid cohesion during mitosis.
Cleaved by caspases during apoptosis.
Phosphorylation by IKBKB/IKKB at Ser-209 promotes its proteasome-mediated degradation.
Autoacetylated at Lys-136 which stimulates its catalytic activity.
Cytoplasm. Nucleus.
Note: Also present in the free cytosolic and cytoskeleton-bound polysomes.
Ubiquitous.
Belongs to the acetyltransferase family. ARD1 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.