C1orf31 Antibody - #DF12867
Product: | C1orf31 Antibody |
Catalog: | DF12867 |
Description: | Rabbit polyclonal antibody to C1orf31 |
Application: | WB |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Dog, Chicken |
Mol.Wt.: | 14 kDa; 14kD(Calculated). |
Uniprot: | Q5JTJ3 |
RRID: | AB_2845828 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12867, RRID:AB_2845828.
Fold/Unfold
C1orf31; CA031_HUMAN; Chromosome 1 open reading frame 31; COA6; Cytochrome c oxidase assembly factor 6 homolog; Hypothetical protein LOC388753; RP5-827C21.3; Uncharacterized protein C1orf31;
Immunogens
A synthesized peptide derived from human C1orf31, corresponding to a region within the internal amino acids.
- Q5JTJ3 COA6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGPGGPLLSPSRGFLLCKTGWHSNRLLGDCGPHTPVSTALSFIAVGMAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Involved in the maturation of the mitochondrial respiratory chain complex IV subunit MT-CO2/COX2. Thereby, may regulate early steps of complex IV assembly. Mitochondrial respiratory chain complex IV or cytochrome c oxidase is the component of the respiratory chain that catalyzes the transfer of electrons from intermembrane space cytochrome c to molecular oxygen in the matrix and as a consequence contributes to the proton gradient involved in mitochondrial ATP synthesis. May also be required for efficient formation of respiratory supercomplexes comprised of complexes III and IV.
Mitochondrion intermembrane space.
Belongs to the cytochrome c oxidase subunit 6B family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.