C7orf30 Antibody - #DF12871
| Product: | C7orf30 Antibody |
| Catalog: | DF12871 |
| Description: | Rabbit polyclonal antibody to C7orf30 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Pig, Rabbit, Dog |
| Mol.Wt.: | 26 kDa; 26kD(Calculated). |
| Uniprot: | Q96EH3 |
| RRID: | AB_2845832 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12871, RRID:AB_2845832.
Fold/Unfold
C7orf30; CG030_HUMAN; Chromosome 7 open reading frame 30; Uncharacterized protein C7orf30;
Immunogens
- Q96EH3 MASU1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96EH3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S82 | Phosphorylation | Uniprot | |
| Y123 | Phosphorylation | Uniprot | |
| S128 | Phosphorylation | Uniprot | |
| K192 | Ubiquitination | Uniprot |
Research Backgrounds
Required for normal mitochondrial ribosome function and mitochondrial translation. May play a role in ribosome biogenesis by preventing premature association of the 28S and 39S ribosomal subunits (Probable). Interacts with mitochondrial ribosomal protein L14 (MRPL14), probably blocking formation of intersubunit bridge B8, preventing association of the 28S and 39S ribosomal subunits (Probable). Addition to isolated mitochondrial ribosomal subunits partially inhibits translation, probably by interfering with the association of the 28S and 39S ribosomal subunits and the formation of functional ribosomes (Probable). May also participate in the assembly and/or regulation of the stability of the large subunit of the mitochondrial ribosome. May function as a ribosomal silencing factor (Probable).
Mitochondrion matrix.
Note: Colocalizes with MRPL12 and/or MRPL14.
Associates with the mitochondrial ribosome large subunit (39S) via interaction with MRPL12 and/or MRPL14. The interaction generates steric hindrance that is expected to prevent premature association of the 28S and 39S ribosomal subunits. Intentified in a complex composed of MALSU1, MIEF1 upstream open reading frame protein and NDUFAB1; within the trimeric complex MIEF1 upstream open reading frame protein functions as a bridging scaffold that interacts with MALSU1 on one side, and with NDUFAB1 on the other side. Interacts with MRPL12 and MRPL14.
Belongs to the Iojap/RsfS family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.