Product: KLK3 Antibody
Catalog: AF0246
Description: Rabbit polyclonal antibody to KLK3
Application: WB IHC
Reactivity: Human, Mouse
Mol.Wt.: 34kDa; 29kD(Calculated).
Uniprot: P07288
RRID: AB_2833421

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
KLK3 Antibody detects endogenous levels of total KLK3.
RRID:
AB_2833421
Cite Format: Affinity Biosciences Cat# AF0246, RRID:AB_2833421.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

antigen, prostate-specific; APS; Gamma seminoprotein; Gamma-seminoprotein; hK3; Kallikrein 3; Kallikrein related peptidase 3; Kallikrein-3; KLK 3; KLK2A1; Klk3; KLK3_HUMAN; P-30 antigen; P30 antigen; Prostate-specific antigen; Psa; Semenogelase; Seminin;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
KLK3 Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum. Belongs to the peptidase S1 family. Kallikrein subfamily.
Sequence:
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

PTMs - P07288 As Substrate

Site PTM Type Enzyme
T143 Phosphorylation
T167 Phosphorylation
K251 Ubiquitination
K254 Ubiquitination

Research Backgrounds

Function:

Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Forms a heterodimer with SERPINA5.

Family&Domains:

Belongs to the peptidase S1 family. Kallikrein subfamily.

Research Fields

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Prostate cancer.   (View pathway)

References

1). Pongamol Alleviates Neuroinflammation and Promotes Autophagy in Alzheimer's Disease by Regulating the Akt/mTOR Signaling Pathway. Journal of agricultural and food chemistry, 2024 (PubMed: 38841893) [IF=5.7]

2). Dihydroartemisinin-ursodeoxycholic acid conjugate is a potential treatment agent for inflammatory bowel disease. International Immunopharmacology, 2023 (PubMed: 36842236) [IF=4.8]

3). Revealing the mechanism of ethyl acetate extracts of Semen Impatientis against prostate cancer based on network pharmacology and transcriptomics. Journal of ethnopharmacology, 2024 (PubMed: 38643863) [IF=4.8]

4). Sodium Danshensu Cream Promotes the Healing of Pressure Ulcers in Mice through the Nrf2/HO-1 and NF-κB Pathways. Pharmaceuticals, 2022 (PubMed: 36558999) [IF=4.6]

Application: WB    Species: Mouse    Sample:

Figure 7. Effect of SDSS on the protein levels of the NF-κB pathway (n = 5). (A) Western blot; the protein expression levels of NF-κB p65 (B), NF-κB p50 (C), IKKα (D), IKKβ (E), and IκBα (F) levels. * p < 0.05, ** p < 0.01 when compared to the control group. # p < 0.05, ## p < 0.01 when compared to the positive group.

5). Sodium acetate alleviated high-carbohydrate induced intestinal inflammation by suppressing MAPK and NF-κB signaling pathways in Nile tilapia (Oreochromis niloticus). Fish & Shellfish Immunology, 2020 (PubMed: 31730927) [IF=4.1]

6). The beneficial effects of Rosuvastatin in inhibiting inflammation in sepsis. Aging, 2024 (PubMed: 38885061) [IF=3.9]

7). Wenshenqianlie capsule improves benign prostatic hyperplasia via its anti-inflammatory and antioxidant effects. Aging, 2024 (PubMed: 39237304) [IF=3.9]

Application: IHC    Species: Mouse    Sample:

Figure 3. WSQL improved BPH symptoms and reduced serum hormone and growth factor levels. (A) IHC staining for PSA in prostate. Magnification: 200×, scale bar: 50 μm. (B) Quantitative analyses of IHC staining for PSA in prostate were reported as the fold change of the Ctrl group. Effect of WSQL on levels of (C) DHT, (D) T, (E) ASD and (F) TGF-α in serum. The data are presented as the mean ± SEM. ### p < 0.001, ## p < 0.01 and # p < 0.05 vs. Ctrl group, *** p < 0.001, ** p < 0.01 and * p < 0.05 vs. BPH group. n = 3 for (A) and (B) and n = 6 for (C–F).

8). Laminaria japonica fucoidan ameliorates cyclophosphamide‐induced liver and kidney injury possibly by regulating Nrf2/HO‐1 and TLR4/NF‐κB signaling pathways. Journal of the Science of Food and Agriculture, 2022 (PubMed: 34689333) [IF=3.3]

9). Capsaicin reduces blood glucose and prevents prostate growth by regulating androgen, RAGE/IGF-1/Akt, TGF-β/Smad signalling pathway and reversing epithelial-mesenchymal transition in streptozotocin-induced diabetic mice. Naunyn-Schmiedeberg's archives of pharmacology, 2024 (PubMed: 38700794) [IF=3.1]

10). Pyrroloquinoline quinone ameliorates liver injury in mice induced by cyclophosphamide. Environmental Science and Pollution Research, 2022 (PubMed: 34997497)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.