| Product: | CDC26 Antibody |
| Catalog: | DF12891 |
| Description: | Rabbit polyclonal antibody to CDC26 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 10 kDa, 20 kDa(Observed); 10kD(Calculated). |
| Uniprot: | Q8NHZ8 |
| RRID: | AB_2845852 |
Control Products
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12891, RRID:AB_2845852.
Fold/Unfold
ANAPC12; Anaphase promoting complex subunit 12; Anaphase promoting complex subunit CDC26; APC12; BWK 2; C9orf17; Cdc26; CDC26 subunit of anaphase promoting complex; Cell division cycle 26; Cell division cycle 26 homolog (S. cerevisiae); Cell division cycle protein 26 homolog; Chromosome 9 open reading frame 17; Hcn1; OTTMUSP00000015243; OTTMUSP00000015244; Protein BWK 2;
Immunogens
A synthesized peptide derived from human CDC26, corresponding to a region within the internal amino acids.
- Q8NHZ8 CDC26_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex.
Nucleus.
Belongs to the CDC26 family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Organismal Systems > Endocrine system > Progesterone-mediated oocyte maturation.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.