CHCHD10 Antibody - #DF12893
| Product: | CHCHD10 Antibody |
| Catalog: | DF12893 |
| Description: | Rabbit polyclonal antibody to CHCHD10 |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 14 kDa; 14kD(Calculated). |
| Uniprot: | Q8WYQ3 |
| RRID: | AB_2845854 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12893, RRID:AB_2845854.
Fold/Unfold
C22orf16; CHC10_HUMAN; CHCHD10; Chromosome 22 open reading frame 16; Coiled coil helix coiled coil helix domain containing 10; Coiled coil helix coiled coil helix domain containing protein 10 mitochondrial; Coiled-coil-helix-coiled-coil-helix domain-containing protein 10; MGC70831; mitochondrial; N27C7-4; OTTHUMP00000198408; OTTHUMP00000198409; Protein N27C7-4;
Immunogens
- Q8WYQ3 CHC10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8WYQ3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S140 | Phosphorylation | Uniprot |
Research Backgrounds
May be involved in the maintenance of mitochondrial organization and mitochondrial cristae structure.
Mitochondrion intermembrane space.
Note: Enriched at the cristae junctions.
Ubiquitously expressed. Higher expression is observed in heart and liver.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.