CRISP3 Antibody - #DF12915
| Product: | CRISP3 Antibody |
| Catalog: | DF12915 |
| Description: | Rabbit polyclonal antibody to CRISP3 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Monkey |
| Mol.Wt.: | 29 kDa, 38 kDa; 28kD(Calculated). |
| Uniprot: | P54108 |
| RRID: | AB_2845876 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12915, RRID:AB_2845876.
Fold/Unfold
Aeg 2; Aeg2; CRIS3_HUMAN; CRISP 3; CRISP-3; Crisp3; CRS 3; CRS3; Cysteine rich secretory protein 3; Cysteine-rich secretory protein 3; dJ442L6.3; MGC126588; OTTHUMP00000016590; OTTHUMP00000039911; SGP 28; SGP28; SGP28 protein; Specific granule protein (28 kDa); Specific granule protein of 28 kDa;
Immunogens
A synthesized peptide derived from human CRISP3, corresponding to a region within the internal amino acids.
- P54108 CRIS3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY
Research Backgrounds
Secreted.
Note: In neutrophils, localized in specific granules.
Salivary gland, pancreas and prostate > epididymis, ovary, thymus and colon.
Belongs to the CRISP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.