DNAJC7 Antibody - #DF12951
| Product: | DNAJC7 Antibody |
| Catalog: | DF12951 |
| Description: | Rabbit polyclonal antibody to DNAJC7 |
| Application: | WB |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit |
| Mol.Wt.: | 56 kDa; 56kD(Calculated). |
| Uniprot: | Q99615 |
| RRID: | AB_2845912 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12951, RRID:AB_2845912.
Immunogens
- Q99615 DNJC7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q99615 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| Y39 | Phosphorylation | Uniprot | |
| K41 | Ubiquitination | Uniprot | |
| K42 | Ubiquitination | Uniprot | |
| Y48 | Phosphorylation | Uniprot | |
| Y50 | Phosphorylation | Uniprot | |
| Y51 | Phosphorylation | Uniprot | |
| K53 | Ubiquitination | Uniprot | |
| K60 | Ubiquitination | Uniprot | |
| R97 | Methylation | Uniprot | |
| K128 | Acetylation | Uniprot | |
| K128 | Ubiquitination | Uniprot | |
| K137 | Ubiquitination | Uniprot | |
| T151 | Phosphorylation | Uniprot | |
| K155 | Acetylation | Uniprot | |
| K155 | Methylation | Uniprot | |
| K155 | Ubiquitination | Uniprot | |
| C175 | S-Nitrosylation | Uniprot | |
| K182 | Ubiquitination | Uniprot | |
| S207 | Phosphorylation | Uniprot | |
| C219 | S-Nitrosylation | Uniprot | |
| C225 | S-Nitrosylation | Uniprot | |
| R238 | Methylation | Uniprot | |
| K245 | Ubiquitination | Uniprot | |
| K259 | Acetylation | Uniprot | |
| K268 | Ubiquitination | Uniprot | |
| K273 | Acetylation | Uniprot | |
| K273 | Ubiquitination | Uniprot | |
| K291 | Ubiquitination | Uniprot | |
| K295 | Ubiquitination | Uniprot | |
| K306 | Acetylation | Uniprot | |
| K306 | Ubiquitination | Uniprot | |
| K309 | Ubiquitination | Uniprot | |
| K322 | Ubiquitination | Uniprot | |
| Y327 | Phosphorylation | Uniprot | |
| K329 | Ubiquitination | Uniprot | |
| Y355 | Phosphorylation | Uniprot | |
| K359 | Acetylation | Uniprot | |
| K359 | Ubiquitination | Uniprot | |
| K364 | Ubiquitination | Uniprot | |
| K368 | Ubiquitination | Uniprot | |
| K375 | Acetylation | Uniprot | |
| K375 | Ubiquitination | Uniprot | |
| Y382 | Phosphorylation | Uniprot | |
| K384 | Ubiquitination | Uniprot | |
| K390 | Ubiquitination | Uniprot | |
| S393 | Phosphorylation | Uniprot | |
| R412 | Methylation | Uniprot | |
| K422 | Ubiquitination | Uniprot | |
| K429 | Ubiquitination | Uniprot | |
| K442 | Ubiquitination | Uniprot | |
| S449 | Phosphorylation | Uniprot |
Research Backgrounds
Acts as co-chaperone regulating the molecular chaperones HSP70 and HSP90 in folding of steroid receptors, such as the glucocorticoid receptor and the progesterone receptor. Proposed to act as a recycling chaperone by facilitating the return of chaperone substrates to early stages of chaperoning if further folding is required. In vitro, induces ATP-independent dissociation of HSP90 but not of HSP70 from the chaperone-substrate complexes. Recruits NR1I3 to the cytoplasm (By similarity).
Cytoplasm. Nucleus. Cytoplasm>Cytoskeleton.
Note: Colocalizes with NR1I3 to microtubules.
Associates with complexes containing chaperones HSP70 and HSP90. Interacts with the GAP domain of NF1. Interacts with HSP90AA1. Interacts with HSPA1A/B; the interaction is enhanced by ATP. Interacts with HSP90AB1. Interacts with PGR. Interacts with RAD9A; the interaction is interrupted by UV and heat shock treatments. Interacts with HUS1 and RAD1. Interacts with NR1I3. The DNAJC7-NR1I3 complex may also include HSP90 (By similarity). Interacts with HSPA8.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.