DNASE2B Antibody - #DF12952
| Product: | DNASE2B Antibody |
| Catalog: | DF12952 |
| Description: | Rabbit polyclonal antibody to DNASE2B |
| Application: | WB |
| Reactivity: | Human, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog |
| Mol.Wt.: | 42 kDa; 42kD(Calculated). |
| Uniprot: | Q8WZ79 |
| RRID: | AB_2845913 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12952, RRID:AB_2845913.
Fold/Unfold
Deoxyribonuclease 2 beta; Deoxyribonuclease 2 beta precursor; Deoxyribonuclease II beta; DLAD; DNase 2 like acid DNase; DNASE 2B; DNase II beta; DNase II like acid DNase; DNASE2; DNase2 like acid DNase; DNASE2B; DnaseIIb; EC 3.1.22.1; Endonuclease DLAD; Lysosomal DNase II; UOX;
Immunogens
A synthesized peptide derived from human DNASE2B, corresponding to a region within C-terminal amino acids.
Highly expressed in the eye lens and in salivary gland. Detected at lower levels in lung, prostate and lymph node. Isoform 2 is lung specific.
- Q8WZ79 DNS2B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKQKMMARLLRTSFALLFLGLFGVLGAATISCRNEEGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNYSRKYGHTKGLLLWNRVQGFWLIHSIPQFPPIPEEGYDYPPTGRRNGQSGICITFKYNQYEAIDSQLLVCNPNVYSCSIPATFHQELIHMPQLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Hydrolyzes DNA under acidic conditions. Does not require divalent cations for activity. Participates in the degradation of nuclear DNA during lens cell differentiation.
Lysosome.
Highly expressed in the eye lens and in salivary gland. Detected at lower levels in lung, prostate and lymph node. Isoform 2 is lung specific.
Belongs to the DNase II family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.