DPPA2 Antibody - #DF12960
Product: | DPPA2 Antibody |
Catalog: | DF12960 |
Description: | Rabbit polyclonal antibody to DPPA2 |
Application: | WB |
Reactivity: | Human, Monkey |
Mol.Wt.: | 34 kDa; 34kD(Calculated). |
Uniprot: | Q7Z7J5 |
RRID: | AB_2845921 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12960, RRID:AB_2845921.
Fold/Unfold
cancer/testis antigen 100; CT100; Developmental Pluripotency Associated 2; developmental pluripotency-associated gene 2; developmental pluripotency-associated protein 2; ECAT15-2; embryonic stem cell (ESC) associated transcript 15-2; PESCRG1; Pluripotent embryonic stem cell related protein 1; Pluripotent embryonic stem cell-related gene 1; Pluripotent embryonic stem cell-related gene 1 protein;
Immunogens
Expressed in embryonic stem cells. No expression is seen in 5 months embryo, mesenchymal stem cells, embryonic fibrocytes and adult tissues.
- Q7Z7J5 DPPA2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK
PTMs - Q7Z7J5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K57 | Sumoylation | Uniprot | |
R124 | Methylation | Uniprot | |
Y127 | Phosphorylation | Uniprot | |
R148 | Methylation | Uniprot |
Research Backgrounds
Binds to target gene promoters, including NKX2-5 and SYCE1, but not GATA4, and may be involved in the maintenance of the active epigenetic status of these genes.
Nucleus.
Expressed in embryonic stem cells. No expression is seen in 5 months embryo, mesenchymal stem cells, embryonic fibrocytes and adult tissues.
Interacts with DPPA4.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.