FBXO7 Antibody - #DF13008
| Product: | FBXO7 Antibody |
| Catalog: | DF13008 |
| Description: | Rabbit polyclonal antibody to FBXO7 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 58 kDa; 59kD(Calculated). |
| Uniprot: | Q9Y3I1 |
| RRID: | AB_2845969 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13008, RRID:AB_2845969.
Fold/Unfold
F box only protein 7; F box protein 7; F-box only protein 7; FBX; FBX07; FBX7; FBX7_HUMAN; Fbxo7; PARK15; PKPS;
Immunogens
- Q9Y3I1 FBX7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y3I1 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K227 | Ubiquitination | Uniprot | |
| S283 | Phosphorylation | Uniprot | |
| C286 | S-Nitrosylation | Uniprot | |
| K287 | Ubiquitination | Uniprot | |
| K289 | Ubiquitination | Uniprot | |
| K309 | Ubiquitination | Uniprot | |
| T384 | Phosphorylation | Uniprot | |
| K393 | Ubiquitination | Uniprot | |
| R451 | Methylation | Uniprot | |
| R479 | Methylation | Uniprot | |
| R481 | Methylation | Uniprot | |
| R498 | Methylation | Uniprot | |
| R504 | Methylation | Uniprot |
Research Backgrounds
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes BIRC2 and DLGAP5. Plays a role downstream of PINK1 in the clearance of damaged mitochondria via selective autophagy (mitophagy) by targeting PRKN to dysfunctional depolarized mitochondria. Promotes MFN1 ubiquitination.
Cytoplasm. Nucleus. Mitochondrion. Cytoplasm>Cytosol.
Note: Predominantly cytoplasmic. A minor proportion is detected in the nucleus. Relocates from the cytosol to depolarized mitochondria.
Part of the SCF (SKP1-CUL1-F-box) E3 ubiquitin-protein ligase complex SCF(FBXO7) formed of CUL1, SKP1, RBX1 and FBXO7. Interacts via its C-terminal proline-rich region with DLGAP5. Interacts with BIRC2. Interacts with CDK6 and promotes its interaction with D-type cyclin. Isoform 1 interacts (via the N-terminal Ubl domain) with PRKN. Isoforms that lack the ubiquitin-like domain do not interact with PRKN. Isoform 1 and isoform 2 interact (via N-terminal region) with PINK1. Isoform 3 does not interact with PINK1. Interacts with PSMF1.
The ubiquitin-like region mediates interaction with PRKN.
The proline-rich region is important for protein-protein interactions.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.