FNDC5 Antibody - #DF13019
Product: | FNDC5 Antibody |
Catalog: | DF13019 |
Description: | Rabbit polyclonal antibody to FNDC5 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 20 kDa; 24kD(Calculated). |
Uniprot: | Q8NAU1 |
RRID: | AB_2845980 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13019, RRID:AB_2845980.
Fold/Unfold
Fibronectin type III domain containing 5; Fibronectin type III domain-containing protein 5; Fibronectin type III repeat containing protein 2; Fibronectin type III repeat-containing protein 2; FNDC 5; Fndc5; FNDC5_HUMAN; FRCP2; irisin;
Immunogens
A synthesized peptide derived from human FNDC5, corresponding to a region within C-terminal amino acids.
Widely expressed, with highest levels in heart. Very low expression, if any, in colon, pancreas and spleen.
- Q8NAU1 FNDC5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue.
The extracellular domain is cleaved and released from the cell membrane.
N-Glycosylated.
Cell membrane>Single-pass type I membrane protein. Peroxisome membrane>Single-pass type I membrane protein.
Note: Imported in peroxisomes through the PEX5 receptor pathway.
Secreted.
Note: Detected in the blood of individuals subjected to endurance exercise.
Widely expressed, with highest levels in heart. Very low expression, if any, in colon, pancreas and spleen.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.