HIST1H1T Antibody - #DF13061
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13061, RRID:AB_2846022.
Fold/Unfold
H1 histone family, member T (testis specific); H1FT; H1T; H1T_HUMAN; Hist1h1t; Histone cluster 1, H1t; Histone H1t; Testicular H1 histone;
Immunogens
- P22492 H1T_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMSLVALKKALAAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKSTRSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQKSPVKARASKSKLTQHHEVNVRKATSKK
PTMs - P22492 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T22 | Phosphorylation | Uniprot | |
| K68 | Sumoylation | Uniprot | |
| K68 | Ubiquitination | Uniprot | |
| Y75 | Phosphorylation | Uniprot | |
| K79 | Acetylation | Uniprot | |
| K79 | Ubiquitination | Uniprot | |
| S82 | Phosphorylation | Uniprot | |
| T103 | Phosphorylation | Uniprot | |
| S106 | Phosphorylation | Uniprot | |
| S108 | Phosphorylation | Uniprot | |
| K110 | Acetylation | Uniprot | |
| K113 | Acetylation | Uniprot | |
| S141 | Phosphorylation | Uniprot | |
| S143 | Phosphorylation | Uniprot | |
| T149 | Phosphorylation | Uniprot | |
| T159 | Phosphorylation | Uniprot | |
| T160 | Phosphorylation | Uniprot | |
| K162 | Acetylation | Uniprot | |
| K171 | Acetylation | Uniprot |
Research Backgrounds
Testis-specific histone H1 that forms less compacted chromatin compared to other H1 histone subtypes. Formation of more relaxed chromatin may be required to promote chromatin architecture required for proper chromosome regulation during meiosis, such as homologous recombination. Histones H1 act as linkers that bind to nucleosomes and compact polynucleosomes into a higher-order chromatin configuration (Probable).
Phosphorylated in early spermatids.
Citrullination at Arg-58 (H1R54ci) by PADI4 takes place within the DNA-binding site of H1 and results in its displacement from chromatin and global chromatin decondensation, thereby promoting pluripotency and stem cell maintenance.
Nucleus. Chromosome.
Testis-specific.
Belongs to the histone H1/H5 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.