HOXC4 Antibody - #DF13069
Product: | HOXC4 Antibody |
Catalog: | DF13069 |
Description: | Rabbit polyclonal antibody to HOXC4 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 30 kDa; 30kD(Calculated). |
Uniprot: | P09017 |
RRID: | AB_2846030 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13069, RRID:AB_2846030.
Fold/Unfold
CP 19; CP19; Homeo box 3E; Homeo box C4; Homeo box protein HoxC4; Homeobox 3E; Homeobox C4; Homeobox protein CP19; Homeobox protein Hox C4; Homeobox protein Hox-3E; Homeobox protein Hox-C4; Homeobox protein HoxC4; Homeobox3E; HomeoboxC4; HOX 3; Hox 3E; HOX C4; HOX3; Hox3E; HOXC 4; Hoxc4; HXC4_HUMAN;
Immunogens
A synthesized peptide derived from human HOXC4, corresponding to a region within N-terminal amino acids.
- P09017 HXC4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Nucleus.
Belongs to the Antp homeobox family. Deformed subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.