IFT43 Antibody - #DF13084
| Product: | IFT43 Antibody |
| Catalog: | DF13084 |
| Description: | Rabbit polyclonal antibody to IFT43 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Pig |
| Mol.Wt.: | 24 kDa; 24kD(Calculated). |
| Uniprot: | Q96FT9 |
| RRID: | AB_2846044 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13084, RRID:AB_2846044.
Fold/Unfold
C14orf179; ift43; IFT43_HUMAN; Intraflagellar transport protein 43 homolog;
Immunogens
- Q96FT9 IFT43_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKASKFRRKASEEIEDFRLRPQSLNGSDYGGDIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96FT9 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| S43 | Phosphorylation | Uniprot | |
| S67 | Phosphorylation | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| K76 | Ubiquitination | Uniprot | |
| S78 | Phosphorylation | Uniprot | |
| T131 | Phosphorylation | Uniprot | |
| Y132 | Phosphorylation | Uniprot | |
| K159 | Ubiquitination | Uniprot |
Research Backgrounds
As a component of IFT complex A (IFT-A), a complex required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs), it is involved in ciliogenesis. Involved in retrograde ciliary transport along microtubules from the ciliary tip to the base.
Cytoplasm>Cytoskeleton. Cell projection>Cilium.
Note: Associated with microtubules (PubMed:22361696). Localized at the distal tip of the cilium (PubMed:28973684).
Expressed in the retina, predominantly in the photoreceptor outer segment.
Component of the IFT complex A (IFT-A) complex. IFT-A complex is divided into a core subcomplex composed of IFT122:IFT140:WDR19 which is associated with TULP3 and a peripheral subcomplex composed of IFT43:WDR35:TTC21B. Interacts directy with IFT122, WDR35 and TTC21B.
Belongs to the IFT43 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.