LIN7C Antibody - #DF13130
Product: | LIN7C Antibody |
Catalog: | DF13130 |
Description: | Rabbit polyclonal antibody to LIN7C |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 25 kDa; 22kD(Calculated). |
Uniprot: | Q9NUP9 |
RRID: | AB_2846090 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13130, RRID:AB_2846090.
Fold/Unfold
LIN 7 C; Lin 7 homolog C (C. elegans); LIN 7 protein 3; LIN 7C; LIN7 protein 3; MALS 3; MALS3; Mammalian lin seven protein 3; Protein lin 7 homolog C; Veli 3; Veli 3 protein; VELI3; Vertebrate lin 7 homolog 3;
Immunogens
- Q9NUP9 LIN7C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NUP9 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
R9 | Methylation | Uniprot | |
K23 | Ubiquitination | Uniprot | |
K34 | Ubiquitination | Uniprot | |
S44 | Phosphorylation | Uniprot | |
Y58 | Phosphorylation | Uniprot | |
K76 | Ubiquitination | Uniprot | |
T78 | Phosphorylation | Uniprot | |
K111 | Ubiquitination | Uniprot | |
S115 | Phosphorylation | Uniprot | |
R130 | Methylation | Uniprot | |
K161 | Ubiquitination | Uniprot | |
K176 | Ubiquitination | Uniprot | |
S190 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.
Cell membrane>Peripheral membrane protein. Basolateral cell membrane>Peripheral membrane protein. Cell junction. Cell junction>Synapse>Postsynaptic density membrane>Peripheral membrane protein. Cell junction>Tight junction.
Note: Mainly basolateral in renal epithelial cells.
Forms two exclusive ternary complexes with CASK and APBA1 or CASKIN1 (By similarity). Can also interact with other modular proteins containing protein-protein interaction domains like MPP5, MPP6, MPP7, DLG1, DLG2 and DLG3 through its L27 domain. Interacts with DLG4 and GRIN2B as well as CDH1 and CTNNB1, the channels KCNJ12/Kir2.2, KCNJ4/Kir2.3 and probably KCNJ2/Kir2.1 and SLC6A12/BGT-1 via its PDZ domain. The association of LIN7A with cadherin and beta-catenin is calcium-dependent, occurs at synaptic junctions and requires the actin cytoskeleton. Interacts with EGFR, ERBB2, ERBB3 and ERBB4 with both PDZ and KID domains. Associates with KIF17 via APBA1. Interacts with HTR4 (By similarity). Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C). Interacts with MAPK12 (By similarity).
The kinase interacting site is required for proper delivery of ERBB2 to the basolateral membrane.
The PDZ domain regulates endocytosis and recycling of the receptor at the membrane.
The L27 domain mediates interaction with CASK and is involved in the formation of multimeric complexes and the association of LIN7 to membranes.
Belongs to the lin-7 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.