LOH12CR1 Antibody - #DF13131
| Product: | LOH12CR1 Antibody |
| Catalog: | DF13131 |
| Description: | Rabbit polyclonal antibody to LOH12CR1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | Q969J3 |
| RRID: | AB_2846091 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13131, RRID:AB_2846091.
Fold/Unfold
L12R1_HUMAN; loh12cr1; Loss of heterozygosity 12 chromosomal region 1 protein;
Immunogens
- Q969J3 BORC5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q969J3 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| G2 | Myristoylation | Uniprot | |
| S6 | Phosphorylation | Uniprot | |
| S18 | Phosphorylation | Uniprot | |
| S23 | Phosphorylation | Uniprot | |
| K67 | Ubiquitination | Uniprot | |
| S71 | Phosphorylation | Uniprot | |
| T74 | Phosphorylation | Uniprot | |
| S75 | Phosphorylation | Uniprot | |
| T77 | Phosphorylation | Uniprot | |
| K80 | Ubiquitination | Uniprot | |
| S175 | Phosphorylation | Uniprot |
Research Backgrounds
As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. Thereby, it may indirectly play a role in cell spreading and motility.
Myristoylation at Gly-2 mediates attachment to lysosome membranes.
Lysosome membrane>Lipid-anchor>Cytoplasmic side.
Ubiquitously expressed (at protein level).
Component of the BLOC-one-related complex (BORC) which is composed of BLOC1S1, BLOC1S2, BORCS5, BORCS6, BORCS7, BORCS8, KXD1 and SNAPIN. Interacts with ARL8B, KIF5A, KLC1 and PLEKHM2; links the lysosomal BORC complex to the microtubule plus-end-directed kinesin motor.
Belongs to the BORCS5 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.