LSM4 Antibody - #DF13133
| Product: | LSM4 Antibody |
| Catalog: | DF13133 |
| Description: | Rabbit polyclonal antibody to LSM4 |
| Application: | |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 15 kDa(Observed); 15kD(Calculated). |
| Uniprot: | Q9Y4Z0 |
| RRID: | AB_2846093 |
Control Products
Related Downloads
Protocols
Product Info
Cite Format: Affinity Biosciences Cat# DF13133, RRID:AB_2846093.
Fold/Unfold
Glycine rich protein; GRP; LSM 4; LSM4 homolog; LSM4 homolog U6 small nuclear RNA associated (S. cerevisiae); LSM4 homolog U6 small nuclear RNA associated; U6 small nuclear RNA associated; U6 snRNA associated Sm like protein 4; U6 snRNA associated Sm like protein; U6 snRNA associated Sm like protein LSm 4; U6 snRNA associated Sm like protein LSm4; YER 112W; YER112W;
Immunogens
A synthesized peptide derived from human LSM4, corresponding to a region within the internal amino acids.
- Q9Y4Z0 LSM4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.
Nucleus.
Belongs to the snRNP Sm proteins family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > RNA degradation.
· Genetic Information Processing > Transcription > Spliceosome.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.