MMS2 Antibody - #DF13154
Product: | MMS2 Antibody |
Catalog: | DF13154 |
Description: | Rabbit polyclonal antibody to MMS2 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 16 kDa; 16kD(Calculated). |
Uniprot: | Q15819 |
RRID: | AB_2846114 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13154, RRID:AB_2846114.
Fold/Unfold
1 alpha 25 dihydroxyvitamin D3 inducible; DDVit 1; DDVIT1; EDAF-1; EDAF1; EDPF-1; EDPF1; Enterocyte differentiation associated factor EDAF 1; Enterocyte differentiation promoting factor; Enterocyte differentiation-associated factor 1; Enterocyte differentiation-promoting factor 1; Methyl methanesulfonate sensitive 2; MMS 2; MMS2; MMS2 homolog; UB2V2_HUMAN; UBE2V 2; UBE2V2; Ubiquitin conjugating enzyme E2 variant 2; Ubiquitin conjugating enzyme E2v2; Ubiquitin-conjugating enzyme E2 variant 2; UEV 2; UEV2; Vitamin D3 inducible protein; Vitamin D3-inducible protein;
Immunogens
A synthesized peptide derived from human MMS2, corresponding to a region within the internal amino acids.
Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues.
- Q15819 UB2V2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
Detected in placenta, colon, liver and skin. Detected at very low levels in most tissues.
Belongs to the ubiquitin-conjugating enzyme family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.