MSRA Antibody - #DF13157
| Product: | MSRA Antibody |
| Catalog: | DF13157 |
| Description: | Rabbit polyclonal antibody to MSRA |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 26 kDa; 26kD(Calculated). |
| Uniprot: | Q9UJ68 |
| RRID: | AB_2846117 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13157, RRID:AB_2846117.
Fold/Unfold
Cytosolic methionine S sulfoxide reductase; Methionine sulphoxide reductase A; Mitochondrial peptide methionine sulfoxide reductase; MSR A; msrA; MSRA_HUMAN; peptide met (O) reductase; Peptide Met(O) reductase; Peptide methionine (S) S oxide reductase; Peptide-methionine (S)-S-oxide reductase; PMSR; Protein methionine S oxide reductase; Protein-methionine-S-oxide reductase;
Immunogens
Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.
- Q9UJ68 MSRA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UJ68 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K41 | Methylation | Uniprot | |
| K49 | Methylation | Uniprot | |
| K106 | Ubiquitination | Uniprot | |
| K112 | Ubiquitination | Uniprot | |
| S129 | Phosphorylation | Uniprot | |
| K167 | Ubiquitination | Uniprot | |
| K176 | Ubiquitination | Uniprot | |
| K181 | Ubiquitination | Uniprot |
Research Backgrounds
Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.
Mitochondrion.
Cytoplasm.
Cytoplasm. Nucleus.
Cytoplasm. Membrane>Lipid-anchor.
Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.
Belongs to the MsrA Met sulfoxide reductase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.