MTF2 Antibody - #DF13158
Product: | MTF2 Antibody |
Catalog: | DF13158 |
Description: | Rabbit polyclonal antibody to MTF2 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 60 kDa; 67kD(Calculated). |
Uniprot: | Q9Y483 |
RRID: | AB_2846118 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13158, RRID:AB_2846118.
Fold/Unfold
DJ976O13.2; hPCl2; M96; metal regulatory transcription factor 2; Metal response element binding transcription factor 2; metal-response element DNA-binding protein M96; PCL2; polycomb-like 2; polycomb-like protein 2; Putative DNA binding protein; RP5 976O13.1; RP5-976O13.1; TDRD19A; tudor domain containing 19A;
Immunogens
- Q9Y483 MTF2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFKAEKEPEGTSHEFKIKGRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y483 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S10 | Phosphorylation | Uniprot | |
T24 | Phosphorylation | Uniprot | |
S27 | Phosphorylation | Uniprot | |
T29 | Phosphorylation | Uniprot | |
K30 | Methylation | Uniprot | |
K45 | Methylation | Uniprot | |
K161 | Ubiquitination | Uniprot | |
K179 | Ubiquitination | Uniprot | |
Y245 | Phosphorylation | Uniprot | |
K313 | Ubiquitination | Uniprot | |
Y327 | Phosphorylation | Uniprot | |
K378 | Methylation | Uniprot | |
S401 | Phosphorylation | Uniprot | |
K412 | Methylation | Uniprot | |
K416 | Methylation | Uniprot | |
K424 | Ubiquitination | Uniprot | |
S438 | Phosphorylation | Uniprot | |
S452 | Phosphorylation | Uniprot | |
K463 | Ubiquitination | Uniprot | |
Y474 | Phosphorylation | Uniprot | |
S479 | Phosphorylation | Uniprot | |
R480 | Methylation | Uniprot | |
S488 | Phosphorylation | Uniprot | |
K522 | Ubiquitination | Uniprot |
Research Backgrounds
Polycomb group (PcG) that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3) and recruits the PRC2 complex. Acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity. Regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation. Promotes recruitment of the PRC2 complex to the inactive X chromosome in differentiating XX ES cells and PRC2 recruitment to target genes in undifferentiated ES cells. Required to repress Hox genes by enhancing H3K27me3 methylation of the PRC2 complex. In some conditions may act as an inhibitor of PRC2 activity: able to activate the CDKN2A gene and promote cellular senescence by suppressing the catalytic activity of the PRC2 complex locally. Binds to the metal-regulating-element (MRE) of MT1A gene promoter (By similarity).
Nucleus.
Associated component of the PRC2 complex.
The Tudor domain recognizes and binds H3K36me3 (PubMed:23142980, PubMed:23228662).
Belongs to the Polycomblike family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.