NCOA5 Antibody - #DF13175
Product: | NCOA5 Antibody |
Catalog: | DF13175 |
Description: | Rabbit polyclonal antibody to NCOA5 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 66 kDa; 66kD(Calculated). |
Uniprot: | Q9HCD5 |
RRID: | AB_2846135 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13175, RRID:AB_2846135.
Fold/Unfold
bA465L10.6; CIA; Coactivator independent of AF 2; KIAA1637; MGC28864; NCoA 5; NCOA5; Nuclear receptor coactivator 5; OTTMUSP00000001057; RP23-61O3.13;
Immunogens
- Q9HCD5 NCOA5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDLRDHRHSRDLRDHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPTPSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQRSQASGNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGINFDNPSVQKALDTLIQSGPALSHLVSQTTAQMGQPQAPMGSYQRHY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9HCD5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
T3 | Phosphorylation | Uniprot | |
S6 | Phosphorylation | Uniprot | |
S9 | Phosphorylation | Uniprot | |
T11 | Phosphorylation | Uniprot | |
R13 | Methylation | Uniprot | |
S21 | Phosphorylation | Uniprot | |
S24 | Phosphorylation | Uniprot | |
S29 | Phosphorylation | Uniprot | |
S34 | Phosphorylation | Uniprot | |
S51 | Phosphorylation | Uniprot | |
S66 | Phosphorylation | Uniprot | |
S75 | Phosphorylation | Uniprot | |
S96 | Phosphorylation | Uniprot | |
Y107 | Phosphorylation | Uniprot | |
S116 | Phosphorylation | Uniprot | |
S126 | Phosphorylation | Uniprot | |
Y127 | Phosphorylation | Uniprot | |
Y136 | Phosphorylation | Uniprot | |
S143 | Phosphorylation | Uniprot | |
Y144 | Phosphorylation | Uniprot | |
S151 | Phosphorylation | Uniprot | |
S162 | Phosphorylation | Uniprot | |
S164 | Phosphorylation | Uniprot | |
Y184 | Phosphorylation | Uniprot | |
S215 | Phosphorylation | Uniprot | |
T267 | Phosphorylation | Uniprot | |
T274 | Phosphorylation | Uniprot | |
K362 | Ubiquitination | Uniprot | |
S377 | Phosphorylation | Uniprot | |
S378 | Phosphorylation | Uniprot | |
T379 | Phosphorylation | Uniprot | |
S381 | Phosphorylation | Uniprot | |
S387 | Phosphorylation | Uniprot | |
T394 | Phosphorylation | Uniprot | |
S395 | Phosphorylation | Uniprot | |
S398 | Phosphorylation | Uniprot | |
S404 | Phosphorylation | Uniprot | |
T418 | Phosphorylation | Uniprot | |
T420 | Phosphorylation | Uniprot | |
S477 | Phosphorylation | Uniprot | |
R500 | Methylation | Uniprot | |
S505 | Phosphorylation | Uniprot | |
R515 | Methylation | Uniprot | |
S529 | Phosphorylation | Uniprot | |
T546 | Phosphorylation | Uniprot | |
T562 | Phosphorylation | Uniprot |
Research Backgrounds
Nuclear receptor coregulator that can have both coactivator and corepressor functions. Interacts with nuclear receptors for steroids (ESR1 and ESR2) independently of the steroid binding domain (AF-2) of the ESR receptors, and with the orphan nuclear receptor NR1D2. Involved in the coactivation of nuclear steroid receptors (ER) as well as the corepression of MYC in response to 17-beta-estradiol (E2).
Nucleus.
Widely expressed.
Binds HTATIP2/TIP30. Interacts with YLPM1. Forms a complex with ILF2, ILF3, YLPM1, KHDRBS1, RBMX and PPP1CA.
Contains one Leu-Xaa-Xaa-Leu-Leu (LxxLL) motif that is essential for the association with nuclear receptors.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.