NDUFAF2 Antibody - #DF13178
Product: | NDUFAF2 Antibody |
Catalog: | DF13178 |
Description: | Rabbit polyclonal antibody to NDUFAF2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Horse, Rabbit |
Mol.Wt.: | 25 kDa; 20kD(Calculated). |
Uniprot: | Q8N183 |
RRID: | AB_2846138 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13178, RRID:AB_2846138.
Fold/Unfold
B17.2 like; B17.2-like; B17.2L; FLJ22398; MIMIT_HUMAN; Mimitin; Mimitin mitochondrial; mitochondrial; MMTN; Myc induced mitochondrial protein; Myc-induced mitochondrial protein; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 2; NADH dehydrogenase (ubiquinone) complex I, assembly factor 2; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2; NDUFA12 like; NDUFA12 like protein; NDUFA12-like protein; NDUFA12L; NDUFAF2; OTTHUMP00000161882; OTTHUMP00000221703;
Immunogens
A synthesized peptide derived from human NDUFAF2, corresponding to a region within C-terminal amino acids.
Highly expressed in ESCC cells. Also expressed in heart, skeletal muscle, liver, and in fibroblasts.
- Q8N183 NDUF2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acts as a molecular chaperone for mitochondrial complex I assembly. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Mitochondrion.
Highly expressed in ESCC cells. Also expressed in heart, skeletal muscle, liver, and in fibroblasts.
Belongs to the complex I NDUFA12 subunit family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.