OCIAD1 Antibody - #DF13203
| Product: | OCIAD1 Antibody |
| Catalog: | DF13203 |
| Description: | Rabbit polyclonal antibody to OCIAD1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 30 kDa; 28kD(Calculated). |
| Uniprot: | Q9NX40 |
| RRID: | AB_2846163 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13203, RRID:AB_2846163.
Fold/Unfold
Asrij; FLJ20455; MGC111072; OCAD1_HUMAN; OCIA; OCIA domain containing 1; OCIA domain-containing protein 1; OCIAD1; Ovarian carcinoma immunoreactive antigen; TPA018;
Immunogens
Isoform 1 is highly expressed in many tissues, including testis, brain, placenta, ovary, prostate and mammary gland. Isoform 2 expression is restricted to the central nervous system including brain, cerebellum and spinal cord.
- Q9NX40 OCAD1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NX40 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S69 | Phosphorylation | Uniprot | |
| K72 | Acetylation | Uniprot | |
| K72 | Ubiquitination | Uniprot | |
| K96 | Sumoylation | Uniprot | |
| K96 | Ubiquitination | Uniprot | |
| K104 | Ubiquitination | Uniprot | |
| S108 | Phosphorylation | Uniprot | |
| S116 | Phosphorylation | Uniprot | |
| S122 | Phosphorylation | Uniprot | |
| S123 | Phosphorylation | Uniprot | |
| Y128 | Phosphorylation | Uniprot | |
| Y129 | Phosphorylation | Uniprot | |
| K131 | Acetylation | Uniprot | |
| K131 | Ubiquitination | Uniprot | |
| Y159 | Phosphorylation | Uniprot | |
| S165 | Phosphorylation | Uniprot | |
| S191 | Phosphorylation | Uniprot | |
| K195 | Ubiquitination | Uniprot | |
| T198 | Phosphorylation | Uniprot | |
| Y199 | Phosphorylation | Uniprot | |
| S209 | Phosphorylation | Uniprot | |
| Y210 | Phosphorylation | Uniprot | |
| S213 | Phosphorylation | Uniprot | |
| K238 | Ubiquitination | Uniprot |
Research Backgrounds
Maintains stem cell potency (By similarity). Increases STAT3 phosphorylation and controls ERK phosphorylation (By similarity). May act as a scaffold, increasing STAT3 recruitment onto endosomes (By similarity). Involved in integrin-mediated cancer cell adhesion and colony formation in ovarian cancer.
Endosome.
Isoform 1 is highly expressed in many tissues, including testis, brain, placenta, ovary, prostate and mammary gland. Isoform 2 expression is restricted to the central nervous system including brain, cerebellum and spinal cord.
Interacts with STAT3.
The OCIA domain is necessary and sufficient for endosomal localization.
Belongs to the OCIAD1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.