Product: CBX5 Antibody
Catalog: BF0724
Description: Mouse monoclonal antibody to CBX5
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 22kDa; 22kD(Calculated).
Uniprot: P45973
RRID: AB_2846199

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:2000, IHC 1:100-1:1000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Monoclonal [AFB17786]
Specificity:
HP1 alpha Monoclonal Antibody detects endogenous levels of total HP1 alpha.
RRID:
AB_2846199
Cite Format: Affinity Biosciences Cat# BF0724, RRID:AB_2846199.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Antigen p25; CBX5; CBX5_HUMAN; CG8409; Chromobox 5; Chromobox homolog 5 (HP1 alpha homolog, Drosophila); Chromobox homolog 5; Chromobox protein homolog 5; Epididymis luminal protein 25; HEL25; Heterochromatin protein 1 alpha; Heterochromatin protein 1; Heterochromatin protein 1 homolog alpha; HP1 alpha; HP1 alpha homolog; HP1; HP1A; HP1Hs alpha; Su(var)205;

Immunogens

Immunogen:

Purified recombinant fragment of human HP1 alpha expressed in E. Coli.

Uniprot:
Gene(ID):
Sequence:
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS

Research Backgrounds

Function:

Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.

PTMs:

Phosphorylation of HP1 and LBR may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle (By similarity). Phosphorylated during interphase and possibly hyper-phosphorylated during mitosis.

Ubiquitinated.

Subcellular Location:

Nucleus. Chromosome. Chromosome>Centromere.
Note: Colocalizes with HNRNPU in the nucleus (PubMed:19617346). Component of centromeric and pericentromeric heterochromatin. Associates with chromosomes during mitosis. Associates specifically with chromatin during metaphase and anaphase.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.