RIT1 Antibody - #AF0250
| Product: | RIT1 Antibody |
| Catalog: | AF0250 |
| Description: | Rabbit polyclonal antibody to RIT1 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 25kDa; 25kD(Calculated). |
| Uniprot: | Q92963 |
| RRID: | AB_2833425 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0250, RRID:AB_2833425.
Fold/Unfold
GTP binding protein Roc1; GTP-binding protein Rit1; NS8; Ras like protein expressed in many tissues; Ras like without CAAX 1; Ras-like protein expressed in many tissues; Ras-like without CAAX protein 1; RIBB; Ric like expressed in many tissues; Ric-like protein without CAAX motif 1; RIT; RIT1; RIT1_HUMAN; ROC1;
Immunogens
- Q92963 RIT1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q92963 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S14 | Phosphorylation | Uniprot | |
| S19 | Phosphorylation | Uniprot | |
| Y22 | Phosphorylation | Uniprot | |
| T124 | Phosphorylation | Uniprot | |
| K135 | Ubiquitination | Uniprot | |
| K139 | Ubiquitination | Uniprot | |
| Y169 | Phosphorylation | Uniprot | |
| Y170 | Phosphorylation | Uniprot | |
| K187 | Ubiquitination | Uniprot | |
| S209 | Phosphorylation | Uniprot | |
| K214 | Acetylation | Uniprot |
Research Backgrounds
Plays a crucial role in coupling NGF stimulation to the activation of both EPHB2 and MAPK14 signaling pathways and in NGF-dependent neuronal differentiation. Involved in ELK1 transactivation through the Ras-MAPK signaling cascade that mediates a wide variety of cellular functions, including cell proliferation, survival, and differentiation.
Cell membrane.
Expressed in many tissues.
Interacts with AFDN, the C-terminal domain of RALGDS and RLF, but not with RIN1 and PIK3CA. RLF binds exclusively to the active GTP-bound form. Strongly interacts with BRAF, but only weakly with RAF1. BARF and RAF1 association is dependent upon the GTP-bound state. Interacts with RGL3 (By similarity).
Belongs to the small GTPase superfamily. Ras family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.