Elastase Antibody - #DF13226
| Product: | Elastase Antibody |
| Catalog: | DF13226 |
| Description: | Rabbit polyclonal antibody to Elastase |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 29kDa; 29kD(Calculated). |
| Uniprot: | P08861 |
| RRID: | AB_2846245 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13226, RRID:AB_2846245.
Fold/Unfold
CELA3B; Chymotrypsin like elastase family member 3B; ELA3B; Elastase 3B; Elastase IIIB; Protease E;
Immunogens
A synthesized peptide derived from human Elastase(3A+3B), corresponding to a region within the internal amino acids.
- P08861 CEL3B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
Research Backgrounds
Efficient protease with alanine specificity but only little elastolytic activity.
Pancreas. Not detectable in keratinocytes.
Belongs to the peptidase S1 family. Elastase subfamily.
Research Fields
· Organismal Systems > Digestive system > Pancreatic secretion.
· Organismal Systems > Digestive system > Protein digestion and absorption.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.