Bestrophin 2 Antibody - #DF13299
| Product: | Bestrophin 2 Antibody |
| Catalog: | DF13299 |
| Description: | Rabbit polyclonal antibody to Bestrophin 2 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Rabbit |
| Mol.Wt.: | 57kDa(Observed); 57kD(Calculated). |
| Uniprot: | Q8NFU1 |
| RRID: | AB_2846318 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13299, RRID:AB_2846318.
Fold/Unfold
BEST 2; Best disease Bestrophin; BEST2; Bestrophin2; FLJ20132; Vitelliform macular dystrophy 2 homolog; Vitelliform macular dystrophy 2 like 1; Vitelliform macular dystrophy 2 like protein 1; Vitelliform macular dystrophy; VMD2; VMD2 like gene 1; VMD2L1;
Immunogens
A synthesized peptide derived from human Bestrophin 2, corresponding to a region within C-terminal amino acids.
- Q8NFU1 BEST2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGFYMALSAAYRFVLTEGQKRYFEKLVIYCDQYASLIPVSFVLGFYVTLVVNRWWSQYLCMPLPDALMCVVAGTVHGRDDRGRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNKYWVPCVWFSNLAAQARREGRIRDNSALKLLLEELNVFRGKCGMLFHYDWISVPLVYTQVVTIALYSYFLACLIGRQFLDPAQGYKDHDLDLCVPIFTLLQFFFYAGWLKVAEQLINPFGEDDDDFETNFLIDRNFQVSMLAVDEMYDDLAVLEKDLYWDAAEARAPYTAATVFQLRQPSFQGSTFDITLAKEDMQFQRLDGLDGPMGEAPGDFLQRLLPAGAGMVAGGPLGRRLSFLLRKNSCVSEASTGASCSCAVVPEGAAPECSCGDPLLDPGLPEPEAPPPAGPEPLTLIPGPVEPFSIVTMPGPRGPAPPWLPSPIGEEEENLA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Forms calcium-sensitive chloride channels. Permeable to bicarbonate.
Cell membrane>Multi-pass membrane protein.
Mainly confined to the retinal pigment epithelium and colon.
Belongs to the bestrophin family.
Research Fields
· Organismal Systems > Digestive system > Salivary secretion.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.