GDNF Receptor alpha 2 Antibody - #DF13307
| Product: | GDNF Receptor alpha 2 Antibody |
| Catalog: | DF13307 |
| Description: | Rabbit polyclonal antibody to GDNF Receptor alpha 2 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Dog |
| Mol.Wt.: | 51kDa; 52kD(Calculated). |
| Uniprot: | O00451 |
| RRID: | AB_2846326 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13307, RRID:AB_2846326.
Fold/Unfold
GDNF family receptor alpha 2; GDNF family receptor alpha-2; GDNF receptor alpha-2; GDNF receptor beta; GDNFR beta; GDNFR-alpha-2; GDNFR-beta; GDNFRB; GFR alpha 2; GFR-alpha-2; GFRA 2; Gfra2; GFRA2_HUMAN; Glial cell line derived neurotrophic factor family receptor alpha2b; Glial cell line derived neurotrophic factor receptor beta; Neurturin receptor alpha; NRTNR alpha; NRTNR-alpha; NTNR alpha; NTNR-alpha; NTNRA; PI linked cell surface accessory protein; PI linked cell-surface accessory protein; RET ligand 2; RETL 2; RETL2; TGF beta related neurotrophic factor receptor 2; TGF-beta-related neurotrophic factor receptor 2; TRN receptor GPI anchored; TRNR 2; TRNR2;
Immunogens
A synthesized peptide derived from human GDNF Receptor alpha 2, corresponding to a region within the internal amino acids.
- O00451 GFRA2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Receptor for neurturin. Mediates the NRTN-induced autophosphorylation and activation of the RET receptor. Also able to mediate GDNF signaling through the RET tyrosine kinase receptor.
participates in NRTN-induced 'Ser-727' phosphorylation of STAT3.
Cell membrane>Lipid-anchor.
Isoform 1 is found in both brain and placenta.
Belongs to the GDNFR family.
References
Application: WB Species: Mouse Sample: lung tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.