Product: CXCL16 Antibody
Catalog: DF13312
Description: Rabbit polyclonal antibody to CXCL16
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 27kDa, 45 kDa; 28kD(Calculated).
Uniprot: Q9H2A7
RRID: AB_2846331

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CXCL16 Antibody detects endogenous levels of total CXCL16.
RRID:
AB_2846331
Cite Format: Affinity Biosciences Cat# DF13312, RRID:AB_2846331.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C-X-C motif chemokine 16; Chemokine (C X C motif) ligand 16; Chemokine, CXC motif, ligand 16; CXC chemokine ligand 16; Cxcl16; CXCLG16; CXL16_HUMAN; Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; SCYB16; Small inducible cytokine B16 precursor; Small-inducible cytokine B16; SR-PSOX; SRPSOX; Transmembrane chemokine CXCL16; UNQ2759/PRO6714;

Immunogens

Immunogen:

A synthesized peptide derived from human CXCL16, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q9H2A7 CXL16_HUMAN:

Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.

Sequence:
MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT

Research Backgrounds

Function:

Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo.

PTMs:

Glycosylated.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein. Secreted.
Note: Also exists as a soluble form.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.

Family&Domains:

Belongs to the intercrine alpha (chemokine CxC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

References

1). Curcumin targets CXCL16-mediated podocyte injury and lipid accumulation in diabetic kidney disease treatment. Archives of pharmacal research, 2024 (PubMed: 39607647) [IF=6.7]

2). Traditional Chinese Medicine Shi-Bi-Man ameliorates psoriasis via inhibiting IL-23/Th17 axis and CXCL16-mediated endothelial activation. Chinese medicine, 2024 (PubMed: 38429819) [IF=5.3]

Application: IF/ICC    Species: Human    Sample: T cells

Fig. 7 SBM inhibits endothelial cells inflammatory response through Cxcl16. A Heatmap for CXCL signaling network. B Dotplot for the expression of genes related to CXCL signaling in endothelial cells and keratinocytes. C Immunofluorescence images staining for CD31 (green), CXCL16 (red), and DAPI (blue) of skin tissue, scale bar = 20 μm

3). A Mouse Model of Damp-Heat Syndrome in Traditional Chinese Medicine and Its Impact on Pancreatic Tumor Growth. Frontiers in Oncology, 2022 (PubMed: 35957897) [IF=3.5]

Application: WB    Species: Mice    Sample: tumor tissues

Figure 6 Chemokine differences between tumor-bearing mice with and without damp-heat syndrome. (A) Heatmap indicating serum chemokine distribution between the two groups (n = 10 in the T group, n = 9 in the TD group). (B) Heatmap indicating tumor tissue chemokine distribution between the two groups (n = 3 in each group). (C) Relative mRNA expression of tissue chemokines tested by qPCR (n = 10 in the T group, n = 9 in the TD group). (D) Relative protein expression of tissue chemokines tested by western blotting (n = 8 in each group). *p < 0.05, **p < 0.01, ***p < 0.001 compared with the T group.

4). Huangqi decoction ameliorates kidney injury in db/db mice by regulating the BMP/Smad signaling pathway. BMC complementary medicine and therapies, 2023 (PubMed: 37365530) [IF=3.3]

Application: WB    Species: Mouse    Sample: kidneys

Fig. 8 HQD ameliorates lipid metabolism disorders in db/db mice. A. Frozen sections of mouse kidneys were stained with Oil Red O (n = 5). B. IHC staining of mouse paraffin sections for CXCL16 (n = 5). C.D The protein expression levels of CXCL16 in the kidney cortex by Western blot assay (n = 3). *P 

Application: IHC    Species: Mouse    Sample: kidneys

Fig. 8 HQD ameliorates lipid metabolism disorders in db/db mice. A. Frozen sections of mouse kidneys were stained with Oil Red O (n = 5). B. IHC staining of mouse paraffin sections for CXCL16 (n = 5). C.D The protein expression levels of CXCL16 in the kidney cortex by Western blot assay (n = 3). *P 

5). Ginsenoside Rg1 Improves Inflammation and Autophagy of the Pancreas and Spleen in Streptozotocin-Induced Type 1 Diabetic Mice. International Journal of Endocrinology, 2023 (PubMed: 36960388) [IF=2.3]

Application: IF/ICC    Species: Mouse    Sample:

Figure 3 Expressions of CXCL16, CD45, and insulin receptor (INSR) proteins in the pancreas by immunofluorescence (×400, scale: 50 μm, mean ± SD, n = 6) (a–c) the expressions of CXCL16 and CD45 proteins' colocalization in the pancreas. (d–f) The expressions of INSR and CXCL16 proteins colocalization in the pancreas. The fluorescence intensity was detected to observe the protein expression. The increase in CD45 indicated an increase in inflammatory cell infiltration. Those results suggested that Rg1 treatment improves inflammation of the pancreas in type 1 diabetes mice relating to reducing CXCL16. ∗∗p < 0.01, vs. the control group; ##p < 0.01 vs. the DM group.

Application: WB    Species: Mouse    Sample:

Figure 8 The expression of CXCL16, NF-κB, TF, LC3, and P62 proteins in the pancreas and spleens. (Mean ± SD, n = 3) (a–f) the expression of CXCL16, NF-κB, TF, LC3, and P62 proteins in the pancreas. (g–l) The expression of CXCL16, NF-κB, TF, LC3, and P62 proteins in the spleens. The improvement of Rg1 treatment on type 1 diabetes mice was related to the increase of CXCL16, NF-κB, and TF and the raised autophagy (IL3 II/LC 3 I). ∗∗p < 0.01, vs. the control group; ns p > 0.05, ##p < 0.01 vs. the DM group.

6). YAP1/MMP7/CXCL16 axis affects efficacy of neoadjuvant chemotherapy via tumor environment immunosuppression in triple-negative breast cancer. Gland Surgery, 2021 (PubMed: 34733729) [IF=1.5]

Application: WB    Species: Human    Sample: HCC70 cell

Figure 4 Western blotting assay was employed to measure cytoplasmic YAP1 as well as soluble MMP7 and CXCL16 in extracellular matrix in MDA-MB-231 and HCC70 cell lines, respectively. Modulation sequence of protein expression was estimated via YAP1 inhibitor (verteporfin) and MMPs inhibitor (GM6001). Results were statistically analyzed

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.