Product: S100 A1 Antibody
Catalog: AF0251
Description: Rabbit polyclonal antibody to S100 A1
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken
Mol.Wt.: 10kDa; 11kD(Calculated).
Uniprot: P23297
RRID: AB_2833426

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC: 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(85%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(93%)
Clonality:
Polyclonal
Specificity:
S100 A1 Antibody detects endogenous levels of total S100 A1.
RRID:
AB_2833426
Cite Format: Affinity Biosciences Cat# AF0251, RRID:AB_2833426.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Bpb; NEF; Protein S100-A1; S-100 protein alpha chain; S-100 protein subunit alpha; S100 alpha; S100 Alpha Chain; S100; S100 Beta Chain; S100 Calcium Binding Protein A1; S100 Calcium Binding Protein B; S100 Calcium Binding Protein Beta Neural; S100 calcium-binding protein A1; S100 protein alpha polypeptide; S100A; s100a1; S10A1_HUMAN;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P23297 S10A1_HUMAN:

Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.

Description:
S100A1 Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites.
Sequence:
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Rabbit
100
Chicken
93
Zebrafish
85
Xenopus
71
Dog
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P23297 As Substrate

Site PTM Type Enzyme
Y27 Phosphorylation
S43 Phosphorylation
C86 S-Nitrosylation

Research Backgrounds

Function:

Probably acts as a Ca(2+) signal transducer. In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.

Subunit Structure:

Dimer of either two alpha chains, or two beta chains, or one alpha and one beta chain. Also forms heterodimers with S100P. Interacts with AGER (By similarity). Interacts with CAPZA1 (By similarity). Interacts with FKBP4. Interacts with RYR1 and RYR2. Interacts with CACYBP in a calcium-dependent manner. Interacts with PPP5C (via TPR repeats); the interaction is calcium-dependent and modulates PPP5C activity.

Family&Domains:

Belongs to the S-100 family.

References

1). Schwann cell‑derived exosomes induce bone marrow‑derived mesenchymal stem cells to express Schwann cell markers in vitro. Molecular Medicine Reports (PubMed: 32016464) [IF=3.4]

Application: WB    Species: rat    Sample: BMSCs

Figure 3. |mRNA and protein expression levels of Schwann cell markers in differentially‑induced BMSCs. (F and G) Representative immunoblot of protein expression levels of S100, GFAP, NGRF, Sox10, EGR2 and GAPDH in control BMSCs, induced BMSCs, BMSCs + RSC96 exo, BMSCs + Fb exo or RSC96 cells. Data are presented as mean ± SD; *P<0.05, **P<0.01 and ***P<0.001. BMSCs, bone marrow mesenchymal stem cells; EGR2, early growth response 2; Fb exo, fibroblast‑derived exosomes; GFAP, glial fibrillary acidic protein; induced BMSCs, Dezawa's induction method; NGFR, low‑affinity nerve growth factor receptor; RSC96 exo, Schwann cell‑derived exosomes.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.