S100 A1 Antibody - #AF0251
| Product: | S100 A1 Antibody |
| Catalog: | AF0251 |
| Description: | Rabbit polyclonal antibody to S100 A1 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB, IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Chicken |
| Mol.Wt.: | 10kDa; 11kD(Calculated). |
| Uniprot: | P23297 |
| RRID: | AB_2833426 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0251, RRID:AB_2833426.
Fold/Unfold
Bpb; NEF; Protein S100-A1; S-100 protein alpha chain; S-100 protein subunit alpha; S100 alpha; S100 Alpha Chain; S100; S100 Beta Chain; S100 Calcium Binding Protein A1; S100 Calcium Binding Protein B; S100 Calcium Binding Protein Beta Neural; S100 calcium-binding protein A1; S100 protein alpha polypeptide; S100A; s100a1; S10A1_HUMAN;
Immunogens
A synthesized peptide derived from human S100 A1, corresponding to a region within N-terminal amino acids.
Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
- P23297 S10A1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Probably acts as a Ca(2+) signal transducer. In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity.
Cytoplasm.
Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
Belongs to the S-100 family.
References
Application: WB Species: Rat Sample: BMSCs
Application: IF/ICC Species: Rat Sample: BMSCs
Application: WB Species: rat Sample: BMSCs
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.