RBM3 Antibody - #DF13353
Product: | RBM3 Antibody |
Catalog: | DF13353 |
Description: | Rabbit polyclonal antibody to RBM3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 17kDa; 17kD(Calculated). |
Uniprot: | P98179 |
RRID: | AB_2846372 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13353, RRID:AB_2846372.
Fold/Unfold
2600016C11Rik; IS1 RNPL; MGC105811; MGC118410; OTTHUMP00000025800; OTTHUMP00000025802; OTTMUSP00000019634; OTTMUSP00000019635; OTTMUSP00000019636; Putative RNA binding protein 3; Putative RNA-binding protein 3; Rbm3; RBM3_HUMAN; RNA binding motif (RNP1, RRM) protein 3; RNA binding motif protein 3; RNA-binding motif protein 3; RNA-binding protein 3; RNPL; RP23-27I6.7;
Immunogens
A synthesized peptide derived from human RBM3, corresponding to a region within C-terminal amino acids.
- P98179 RBM3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation (By similarity).
Arg-105 is dimethylated, probably to asymmetric dimethylarginine.
Phosphorylated.
Nucleus. Cytoplasm. Cell projection>Dendrite.
Note: Localizes in mRNA granules in dentrites.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.