Dermcidin Antibody - #DF13367
| Product: | Dermcidin Antibody |
| Catalog: | DF13367 |
| Description: | Rabbit polyclonal antibody to Dermcidin |
| Application: | WB IHC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 11kDa; 11kD(Calculated). |
| Uniprot: | P81605 |
| RRID: | AB_2846386 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13367, RRID:AB_2846386.
Fold/Unfold
AIDD; DCD 1; dcd; DCD-1; DCD_HUMAN; Dermcidin; DSEP; HCAP; PIF; Preproteolysin;
Immunogens
A synthesized peptide derived from human Dermcidin, corresponding to a region within the internal amino acids.
Specifically and constitutively expressed in eccrine sweat gland cells. Secreted into the sweat at a concentration of 1-10 micrograms/ml.
- P81605 DCD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Research Backgrounds
DCD-1 displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Highly effective against E.coli, E.faecalis, S.aureus and C.albicans. Optimal pH and salt concentration resemble the conditions in sweat. Also exhibits proteolytic activity, cleaving on the C-terminal side of Arg and, to a lesser extent, Lys residues.
Survival-promoting peptide promotes survival of neurons and displays phosphatase activity. It may bind IgG.
Secreted.
Specifically and constitutively expressed in eccrine sweat gland cells. Secreted into the sweat at a concentration of 1-10 micrograms/ml.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.