Nociceptin Antibody - #DF13385
| Product: | Nociceptin Antibody |
| Catalog: | DF13385 |
| Description: | Rabbit polyclonal antibody to Nociceptin |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 20kDa, 25 kDa; 20kD(Calculated). |
| Uniprot: | Q13519 |
| RRID: | AB_2846404 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13385, RRID:AB_2846404.
Fold/Unfold
N/OFQ; N23K; N23K/N27K; Nociceptin, included; nocistatin; Npnc1; OFQ; OFQ/N; Orphanin FQ; Orphanin FQ2; Pnoc; PNOC_HUMAN; ppN/OFQ; PPNOC; pre-pro-N/OFQ; prepronociceptin; pronociceptin; Propronociceptin;
Immunogens
A synthesized peptide derived from human Nociceptin, corresponding to a region within the internal amino acids.
Predominantly expressed in the brain and spinal cord. Also expressed and secreted by peripheral blood neutrophils following degranulation.
- Q13519 PNOC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development.
Blocks nociceptin action in pain transmission by inhibiting nociceptin-induced hyperalgesia and allodynia.
Has potent analgesic activity.
Specific enzymatic cleavages at paired basic residues probably yield other active peptides besides nociceptin.
The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing.
Secreted.
Predominantly expressed in the brain and spinal cord. Also expressed and secreted by peripheral blood neutrophils following degranulation.
Belongs to the opioid neuropeptide precursor family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.