Surfactant Protein A Antibody - #DF13404
Product: | Surfactant Protein A Antibody |
Catalog: | DF13404 |
Description: | Rabbit polyclonal antibody to Surfactant Protein A |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 26kDa; 26kD(Calculated). |
Uniprot: | Q8IWL1 |
RRID: | AB_2846423 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13404, RRID:AB_2846423.
Immunogens
A synthesized peptide derived from human Surfactant Protein A, corresponding to a region within the internal amino acids.
- Q8IWL1 SFPA2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MWLCPLALNLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Research Backgrounds
In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.
N-acetylated.
Secreted>Extracellular space>Extracellular matrix. Secreted>Extracellular space>Surface film.
Belongs to the SFTPA family.
Research Fields
· Cellular Processes > Transport and catabolism > Phagosome. (View pathway)
· Human Diseases > Infectious diseases: Bacterial > Pertussis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.