FKBP25 Antibody - #DF13423
Product: | FKBP25 Antibody |
Catalog: | DF13423 |
Description: | Rabbit polyclonal antibody to FKBP25 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 25kDa; 25kD(Calculated). |
Uniprot: | Q00688 |
RRID: | AB_2846442 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13423, RRID:AB_2846442.
Fold/Unfold
25 kDa FK506-binding protein; 25 kDa FKBP; FK506 binding protein 25 T cell; FK506 binding protein 25, T cell, 25-KD; FK506 binding protein 3 (25kD); FK506-binding protein 3; FKBP 25; FKBP 3; FKBP-25; FKBP-3; FKBP25; FKBP3; FKBP3_HUMAN; Immunophilin FKBP25; Peptidyl-prolyl cis-trans isomerase FKBP3; PPIase; PPIase FKBP3; Rapamycin binding protein; Rapamycin-selective 25 kDa immunophilin; Rotamase;
Immunogens
- Q00688 FKBP3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q00688 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
T11 | Phosphorylation | Uniprot | |
R16 | Methylation | Uniprot | |
K27 | Ubiquitination | Uniprot | |
S34 | Phosphorylation | Uniprot | |
S36 | Phosphorylation | Uniprot | |
K42 | Ubiquitination | Uniprot | |
K48 | Ubiquitination | Uniprot | |
T75 | Phosphorylation | Uniprot | |
S77 | Phosphorylation | Uniprot | |
S79 | Phosphorylation | Uniprot | |
K80 | Ubiquitination | Uniprot | |
S82 | Phosphorylation | Uniprot | |
K86 | Ubiquitination | Uniprot | |
T98 | Phosphorylation | Uniprot | |
S100 | Phosphorylation | Uniprot | |
T147 | Phosphorylation | Uniprot | |
S152 | Phosphorylation | Uniprot | |
K154 | Acetylation | Uniprot | |
K160 | Acetylation | Uniprot | |
K160 | Ubiquitination | Uniprot | |
S163 | Phosphorylation | Uniprot | |
K165 | Ubiquitination | Uniprot | |
K170 | Acetylation | Uniprot | |
K170 | Ubiquitination | Uniprot | |
R173 | Methylation | Uniprot | |
T181 | Phosphorylation | Uniprot | |
S183 | Phosphorylation | Uniprot | |
K187 | Methylation | Uniprot | |
Y198 | Phosphorylation | Uniprot | |
K200 | Acetylation | Uniprot | |
K200 | Ubiquitination | Uniprot | |
K207 | Ubiquitination | Uniprot |
Research Backgrounds
FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins.
Nucleus.
Belongs to the FKBP-type PPIase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.