Product: SGK1 Antibody
Catalog: AF6001
Description: Rabbit polyclonal antibody to SGK1
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
Mol.Wt.: 57kDa; 49kD(Calculated).
Uniprot: O00141
RRID: AB_2834936

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(91%)
Clonality:
Polyclonal
Specificity:
SGK1 Antibody detects endogenous levels of total SGK1.
RRID:
AB_2834936
Cite Format: Affinity Biosciences Cat# AF6001, RRID:AB_2834936.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

OTTHUMP00000017247; Serine/threonine protein kinase SGK; Serine/threonine protein kinase Sgk1; Serine/threonine-protein kinase Sgk1; Serum and glucocorticoid regulated kinase; Serum/glucocorticoid regulated kinase 1; Serum/glucocorticoid regulated kinase; Serum/glucocorticoid-regulated kinase 1; SGK 1; SGK; SGK1; Sgk1 variant i3; SGK1_HUMAN;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
O00141 SGK1_HUMAN:

Expressed in most tissues with highest levels in the pancreas, followed by placenta, kidney and lung. Isoform 2 is strongly expressed in brain and pancreas, weaker in heart, placenta, lung, liver and skeletal muscle.

Description:
This gene encodes a serine/threonine protein kinase that is highly similar to the rat serum-and glucocorticoid-induced protein kinase (SGK). This gene was identified in a screen of hepatocellular genes regulated in response to cellular hydration or swelling. Cellular hydration is a catabolic signal, stimulating glycogenolysis and proteolysis, and inhibiting protein and glycogen synthesis.
Sequence:
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Zebrafish
100
Chicken
100
Rabbit
100
Xenopus
91
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - O00141 As Substrate

Site PTM Type Enzyme
K41 Acetylation
K50 Ubiquitination
S74 Phosphorylation
S78 Phosphorylation Q13164 (MAPK7)
K94 Ubiquitination
K102 Ubiquitination
K111 Ubiquitination
K118 Ubiquitination
Y124 Phosphorylation
K127 Ubiquitination
K152 Ubiquitination
T256 Phosphorylation O15530 (PDPK1) , Q6A1A2 (PDPK2P)
K271 Ubiquitination
K317 Ubiquitination
K343 Ubiquitination
K367 Ubiquitination
T369 Phosphorylation P17612 (PRKACA)
S377 Phosphorylation Q9HC98 (NEK6)
S397 Phosphorylation
K400 Ubiquitination
S401 Phosphorylation
S422 Phosphorylation O15530 (PDPK1) , O00141 (SGK1) , P42345 (MTOR) , Q9HC98 (NEK6)

PTMs - O00141 As Enzyme

Substrate Site Source
O00141 (SGK1) S422 Uniprot
O00213 (APBB1) S610 Uniprot
O14920 (IKBKB) S181 Uniprot
O15111 (CHUK) T23 Uniprot
O43524 (FOXO3) T32 Uniprot
O43524-1 (FOXO3) S253 Uniprot
O43524 (FOXO3) S315 Uniprot
O60343 (TBC1D4) S318 Uniprot
O60343 (TBC1D4) T568 Uniprot
O60343 (TBC1D4) S588 Uniprot
O60343 (TBC1D4) T642 Uniprot
O60343 (TBC1D4) S751 Uniprot
P10636 (MAPT) S214 Uniprot
P14672 (SLC2A4) S274 Uniprot
P15056 (BRAF) S364 Uniprot
P15056 (BRAF) S365 Uniprot
P16220-2 (CREB1) S119 Uniprot
P16220-1 (CREB1) S133 Uniprot
P25963 (NFKBIA) S32 Uniprot
P28482 (MAPK1) S29 Uniprot
P42568 (MLLT3) S446 Uniprot
P42858 (HTT) S419 Uniprot
P43003-1 (SLC1A3) T482 Uniprot
P45985 (MAP2K4) S80 Uniprot
P46527 (CDKN1B) T157 Uniprot
P46527 (CDKN1B) T198 Uniprot
P48764 (SLC9A3) S663 Uniprot
P49840 (GSK3A) S21 Uniprot
Q00987 (MDM2) S166 Uniprot
Q09472 (EP300) S1834 Uniprot
Q6R327 (RICTOR) T1135 Uniprot
Q92542 (NCSTN) S437 Uniprot
Q92597 (NDRG1) T328 Uniprot
Q92597 (NDRG1) S330 Uniprot
Q92597 (NDRG1) T346 Uniprot
Q92597 (NDRG1) T356 Uniprot
Q92597 (NDRG1) T366 Uniprot
Q969H0 (FBXW7) S227 Uniprot
Q96J92 (WNK4) S1190 Uniprot
Q96J92 (WNK4) S1201 Uniprot
Q96J92 (WNK4) S1217 Uniprot
Q96PU5 (NEDD4L) S342 Uniprot
Q96PU5 (NEDD4L) T367 Uniprot
Q96PU5-5 (NEDD4L) S428 Uniprot
Q96PU5 (NEDD4L) S448 Uniprot
Q99759 (MAP3K3) S166 Uniprot
Q99759 (MAP3K3) S337 Uniprot
Q9H4A3 (WNK1) T60 Uniprot
Q9UN36 (NDRG2) T330 Uniprot
Q9UN36 (NDRG2) S332 Uniprot
Q9UN36 (NDRG2) S346 Uniprot
Q9UN36 (NDRG2) T348 Uniprot
Q9Y2I7 (PIKFYVE) S318 Uniprot
Q9Y2V2 (CARHSP1) S52 Uniprot

Research Backgrounds

Function:

Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cellular enzymes, transcription factors, neuronal excitability, cell growth, proliferation, survival, migration and apoptosis. Plays an important role in cellular stress response. Contributes to regulation of renal Na(+) retention, renal K(+) elimination, salt appetite, gastric acid secretion, intestinal Na(+)/H(+) exchange and nutrient transport, insulin-dependent salt sensitivity of blood pressure, salt sensitivity of peripheral glucose uptake, cardiac repolarization and memory consolidation. Up-regulates Na(+) channels: SCNN1A/ENAC, SCN5A and ASIC1/ACCN2, K(+) channels: KCNJ1/ROMK1, KCNA1-5, KCNQ1-5 and KCNE1, epithelial Ca(2+) channels: TRPV5 and TRPV6, chloride channels: BSND, CLCN2 and CFTR, glutamate transporters: SLC1A3/EAAT1, SLC1A2 /EAAT2, SLC1A1/EAAT3, SLC1A6/EAAT4 and SLC1A7/EAAT5, amino acid transporters: SLC1A5/ASCT2, SLC38A1/SN1 and SLC6A19, creatine transporter: SLC6A8, Na(+)/dicarboxylate cotransporter: SLC13A2/NADC1, Na(+)-dependent phosphate cotransporter: SLC34A2/NAPI-2B, glutamate receptor: GRIK2/GLUR6. Up-regulates carriers: SLC9A3/NHE3, SLC12A1/NKCC2, SLC12A3/NCC, SLC5A3/SMIT, SLC2A1/GLUT1, SLC5A1/SGLT1 and SLC15A2/PEPT2. Regulates enzymes: GSK3A/B, PMM2 and Na(+)/K(+) ATPase, and transcription factors: CTNNB1 and nuclear factor NF-kappa-B. Stimulates sodium transport into epithelial cells by enhancing the stability and expression of SCNN1A/ENAC. This is achieved by phosphorylating the NEDD4L ubiquitin E3 ligase, promoting its interaction with 14-3-3 proteins, thereby preventing it from binding to SCNN1A/ENAC and targeting it for degradation. Regulates store-operated Ca(+2) entry (SOCE) by stimulating ORAI1 and STIM1. Regulates KCNJ1/ROMK1 directly via its phosphorylation or indirectly via increased interaction with SLC9A3R2/NHERF2. Phosphorylates MDM2 and activates MDM2-dependent ubiquitination of p53/TP53. Phosphorylates MAPT/TAU and mediates microtubule depolymerization and neurite formation in hippocampal neurons. Phosphorylates SLC2A4/GLUT4 and up-regulates its activity. Phosphorylates APBB1/FE65 and promotes its localization to the nucleus. Phosphorylates MAPK1/ERK2 and activates it by enhancing its interaction with MAP2K1/MEK1 and MAP2K2/MEK2. Phosphorylates FBXW7 and plays an inhibitory role in the NOTCH1 signaling. Phosphorylates FOXO1 resulting in its relocalization from the nucleus to the cytoplasm. Phosphorylates FOXO3, promoting its exit from the nucleus and interference with FOXO3-dependent transcription. Phosphorylates BRAF and MAP3K3/MEKK3 and inhibits their activity. Phosphorylates SLC9A3/NHE3 in response to dexamethasone, resulting in its activation and increased localization at the cell membrane. Phosphorylates CREB1. Necessary for vascular remodeling during angiogenesis. Sustained high levels and activity may contribute to conditions such as hypertension and diabetic nephropathy. Isoform 2 exhibited a greater effect on cell plasma membrane expression of SCNN1A/ENAC and Na(+) transport than isoform 1.

PTMs:

Regulated by phosphorylation. Activated by phosphorylation on Ser-422 by mTORC2, transforming it into a substrate for PDPK1 which phosphorylates it on Thr-256. Phosphorylation on Ser-397 and Ser-401 are also essential for its activity. Phosphorylation on Ser-78 by MAPK7 is required for growth factor-induced cell cycle progression.

Ubiquitinated by NEDD4L; which promotes proteasomal degradation. Ubiquitinated by SYVN1 at the endoplasmic reticulum; which promotes rapid proteasomal degradation and maintains a high turnover rate in resting cells. Isoform 2 shows enhanced stability.

Subcellular Location:

Cytoplasm. Nucleus. Endoplasmic reticulum membrane. Cell membrane. Mitochondrion.
Note: The subcellular localization is controlled by the cell cycle, as well as by exposure to specific hormones and environmental stress stimuli. In proliferating cells, it shuttles between the nucleus and cytoplasm in synchrony with the cell cycle, and in serum/growth factor-stimulated cells it resides in the nucleus. In contrast, after exposure to environmental stress or treatment with glucocorticoids, it is detected in the cytoplasm and with certain stress conditions is associated with the mitochondria. In osmoregulation through the epithelial sodium channel, it can be localized to the cytoplasmic surface of the cell membrane. Nuclear, upon phosphorylation.

Cell membrane.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in most tissues with highest levels in the pancreas, followed by placenta, kidney and lung. Isoform 2 is strongly expressed in brain and pancreas, weaker in heart, placenta, lung, liver and skeletal muscle.

Subunit Structure:

Homodimer; disulfide-linked. Forms a trimeric complex with FBXW7 and NOTCH1. Interacts with MAPK3/ERK1, MAPK1/ERK2, MAP2K1/MEK1, MAP2K2/MEK2, NEDD4, NEDD4L, MAPT/TAU, MAPK7, CREB1, SLC9A3R2/NHERF2 and KCNJ1/ROMK1. Associates with the mammalian target of rapamycin complex 2 (mTORC2) via an interaction with MAPKAP1/SIN1.

Family&Domains:

Isoform 2 subcellular localization at the cell membrane and resistance to proteasomal degradation is mediated by the sequences within the first 120 amino acids.

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.

Research Fields

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > mTOR signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Organismal Systems > Excretory system > Aldosterone-regulated sodium reabsorption.

References

1). Chen G et al. Eplerenone inhibits UUO-induced lymphangiogenesis and cardiac fibrosis by attenuating inflammatory injury. International Immunopharmacology 2022 Apr 12;108:108759. (PubMed: 35428023) [IF=5.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.