GODZ Antibody - #DF13476
| Product: | GODZ Antibody |
| Catalog: | DF13476 |
| Description: | Rabbit polyclonal antibody to GODZ |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 34kDa; 34kD(Calculated). |
| Uniprot: | Q9NYG2 |
| RRID: | AB_2846495 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13476, RRID:AB_2846495.
Fold/Unfold
DHHC-3; GABA-A receptor-associated membrane protein 1; GODZ; Golgi-specific DHHC zinc finger protein; Gramp1; Palmitoyltransferase ZDHHC3; Protein DHHC1; ZDHC3; ZDHC3_HUMAN; ZDHHC3; Zinc finger DHHC domain-containing protein 3; Zinc finger protein 373; ZNF373;
Immunogens
- Q9NYG2 ZDHC3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9NYG2 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y18 | Phosphorylation | Uniprot | |
| K112 | Ubiquitination | Uniprot | |
| K121 | Ubiquitination | Uniprot | |
| Y127 | Phosphorylation | Uniprot | |
| T231 | Phosphorylation | Uniprot | |
| S232 | Phosphorylation | Uniprot | |
| S241 | Phosphorylation | Uniprot | |
| T286 | Phosphorylation | Uniprot | |
| Y295 | Phosphorylation | Uniprot |
Research Backgrounds
Palmitoyltransferase with broad specificity. Palmitoylates GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3), which regulates synaptic clustering and/or cell surface stability (By similarity). Palmitoylates glutamate receptors GRIA1 and GRIA2, which leads to their retention in Golgi. May also palmitoylate DLG4, DNAJC5 and SNAP25 (By similarity).
Autopalmitoylated.
Golgi apparatus membrane>Multi-pass membrane protein.
The DHHC domain is required for palmitoyltransferase activity.
Belongs to the DHHC palmitoyltransferase family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.