Neurturin Antibody - #DF13481
Product: | Neurturin Antibody |
Catalog: | DF13481 |
Description: | Rabbit polyclonal antibody to Neurturin |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 22kDa; 22kD(Calculated). |
Uniprot: | Q99748 |
RRID: | AB_2846500 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13481, RRID:AB_2846500.
Fold/Unfold
Neurturin; Neurturin precursor; NRTN; NRTN_HUMAN; NTN; prepro-neurturin;
Immunogens
A synthesized peptide derived from human Neurturin, corresponding to a region within C-terminal amino acids.
- Q99748 NRTN_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQRWKAAALASVLCSSVLSIWMCREGLLLSHRLGPALVPLHRLPRTLDARIARLAQYRALLQGAPDAMELRELTPWAGRPPGPRRRAGPRRRRARARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV
Research Backgrounds
Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells.
Secreted.
Homodimer; disulfide-linked.
Belongs to the TGF-beta family. GDNF subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.