MST4 Antibody - #DF13525
| Product: | MST4 Antibody |
| Catalog: | DF13525 |
| Description: | Rabbit polyclonal antibody to MST4 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 46kDa; 47kD(Calculated). |
| Uniprot: | Q9P289 |
| RRID: | AB_2846544 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13525, RRID:AB_2846544.
Fold/Unfold
2610018G03Rik; EC 2.7.11.1; Mammalian Ste20 like protein kinase 4; Mammalian STE20-like protein kinase 4; Mammalian sterile 20 like 4; MASK; MST 4; MST-4; MST3 and SOK1 related kinase; Mst3 and SOK1-related kinase; Mst4; MST4_HUMAN; RGD1563568; RP23-245F8.1; RP6 213H19.1; Serine/threonine protein kinase 26; Serine/threonine protein kinase MASK; Serine/threonine protein kinase MST 4; Serine/threonine protein kinase MST4; Serine/threonine-protein kinase MASK; Serine/threonine-protein kinase MST4; STE20 like kinase MST 4; STE20 like kinase MST4; STE20-like kinase MST4; STK26;
Immunogens
A synthesized peptide derived from human MST4, corresponding to a region within the internal amino acids.
- Q9P289 STK26_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Mediator of cell growth. Modulates apoptosis. In association with STK24 negatively regulates Golgi reorientation in polarized cell migration upon RHO activation.
Cytoplasm. Golgi apparatus.
Note: Colocalized with RIPOR1 in the Golgi of serum-starved cells and relocated to cytoplasmic punctae, probably vesicular compartments, along with RIPOR1 upon serum stimulation in a Rho- and PDCD10-dependent manner (PubMed:27807006).
Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.