Product: SET Antibody
Catalog: DF13529
Description: Rabbit polyclonal antibody to SET
Application: WB IHC IF/ICC
Reactivity: Human, Rat
Mol.Wt.: 33kDa; 33kD(Calculated).
Uniprot: Q01105
RRID: AB_2846548

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
SET Antibody detects endogenous levels of total SET.
RRID:
AB_2846548
Cite Format: Affinity Biosciences Cat# DF13529, RRID:AB_2846548.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2PP2A; HLA DR associated protein II; HLA-DR-associated protein II; I 2PP2A; I-2PP2A; I2PP2A; IGAAD; Inhibitor of granzyme A activated DNase; Inhibitor of granzyme A-activated DNase; Inhibitor of GzmA-activated DNase; inhibitor-2 of protein phosphatase-2A; IPP2A2; PHAPII; Phosphatase 2A inhibitor I2PP2A; protein phosphatase type 2A inhibitor; Protein SET; Set; SET nuclear oncogene; SET translocation; SET translocation (myeloid leukemia-associated); SET_HUMAN; TAF I; TAF IBETA; TAF-I; TAFI; Template activating factor I; Template-activating factor I; Template-Activating Factor-I, chromatin remodelling factor;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q01105 SET_HUMAN:

Widely expressed. Low levels in quiescent cells during serum starvation, contact inhibition or differentiation. Highly expressed in Wilms' tumor.

Sequence:
MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD

PTMs - Q01105 As Substrate

Site PTM Type Enzyme
S7 Phosphorylation
S28 Phosphorylation
K39 Acetylation
R57 Methylation
S63 Phosphorylation
K68 Ubiquitination
K72 Acetylation
K83 Acetylation
K83 Methylation
K83 Ubiquitination
K90 Acetylation
K90 Ubiquitination
Y119 Phosphorylation
T126 Phosphorylation
K132 Acetylation
K132 Methylation
K132 Ubiquitination
S133 Phosphorylation
Y140 Phosphorylation
Y146 Phosphorylation
K150 Acetylation
K150 Ubiquitination
K154 Acetylation
K154 Ubiquitination
S161 Phosphorylation
S165 Phosphorylation
K167 Acetylation
K167 Ubiquitination
K172 Acetylation
K172 Ubiquitination
S175 Phosphorylation
K181 Ubiquitination
K189 Ubiquitination
S191 Phosphorylation

Research Backgrounds

Function:

Multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone chaperoning. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition. Isoform 1 and isoform 2 are potent inhibitors of protein phosphatase 2A. Isoform 1 and isoform 2 inhibit EP300/CREBBP and PCAF-mediated acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins; however, isoform 2 specific activity is higher.

PTMs:

Isoform 2 is phosphorylated on Ser-15 and Ser-24.

Isoform 2 is acetylated on Lys-11.

Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group (By similarity).

N-terminus of isoform 1 is methylated by METTL11A/NTM1. Mainly trimethylated (By similarity).

Cleaved after Lys-176 by GZMA. The cleavage inhibits its nucleosome assembly activity and disrupts the inhibition on NME1.

Subcellular Location:

Cytoplasm>Cytosol. Endoplasmic reticulum. Nucleus>Nucleoplasm.
Note: In the cytoplasm, found both in the cytosol and associated with the endoplasmic reticulum. The SET complex is associated with the endoplasmic reticulum. Following CTL attack and cleavage by GZMA, moves rapidly to the nucleus, where it is found in the nucleoplasm, avoiding the nucleolus. Similar translocation to the nucleus is also observed for lymphocyte-activated killer cells after the addition of calcium.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed. Low levels in quiescent cells during serum starvation, contact inhibition or differentiation. Highly expressed in Wilms' tumor.

Subunit Structure:

Headphone-shaped homodimer. Isoforms 1 and 2 interact directly with each other and with ANP32A within the tripartite INHAT (inhibitor of acetyltransferases) complex. Isoform 1 and isoform 2 interact also with histones. Isoform 2 is a component of the SET complex, composed of at least ANP32A, APEX1, HMGB2, NME1, SET and TREX1, but not NME2 or TREX2. Within this complex, directly interacts with ANP32A, NME1, HMGB2 and TREX1; the interaction with ANP32A is enhanced after cleavage. Interacts with APBB1, CHTOP, SETBP1, SGO1.

(Microbial infection) Interacts with herpes simplex virus 1 VP22.

Family&Domains:

A long alpha helix in the N-terminus mediates dimerization, while the earmuff domain is responsible for core histone and dsDNA binding. The C-terminal acidic domain mediates the inhibition of histone acetyltransferases and is required for the DNA replication stimulatory activity.

Belongs to the nucleosome assembly protein (NAP) family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.