Histone H1.5 Antibody - #DF13539

Product: | Histone H1.5 Antibody |
Catalog: | DF13539 |
Description: | Rabbit polyclonal antibody to Histone H1.5 |
Application: | WB IHC IF/ICC |
Cited expt.: | WB |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 22kDa; 23kD(Calculated). |
Uniprot: | P16401 |
RRID: | AB_2846558 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13539, RRID:AB_2846558.
Fold/Unfold
H1; H1 histone family member 5; H1.5; H15 HUMAN; H15_HUMAN; H1B; H1F5; H1s 3; Hist1h1b; Histone 1 H1b; Histone cluster 1 H1b; Histone H1.5; Histone H1a; Histone H1b; Histone H1s 3; MGC126630; MGC126632;
Immunogens
A synthesized peptide derived from human Histone H1.5, corresponding to a region within N-terminal amino acids.
- P16401 H15_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGLSLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGATPKKAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAAAKKK
Research Backgrounds
Histone H1 protein binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Acts also as a regulator of individual gene transcription through chromatin remodeling, nucleosome spacing and DNA methylation (By similarity).
H1 histones are progressively phosphorylated during the cell cycle, becoming maximally phosphorylated during late G2 phase and M phase, and being dephosphorylated sharply thereafter (By similarity). Phosphorylated at Thr-11 by GSK3B during mitosis in prometaphase and dephosphorylated in telophase.
Citrullination at Arg-57 (H1R54ci) by PADI4 takes place within the DNA-binding site of H1 and results in its displacement from chromatin and global chromatin decondensation, thereby promoting pluripotency and stem cell maintenance.
Nucleus. Chromosome.
Note: According to PubMed:15911621 more commonly found in heterochromatin. According to PubMed:10997781 associates with actively transcribed chromatin and not heterochromatin.
Ubiquitous. Expressed in the majority of the cell lines tested and in testis.
The C-terminal domain is required for high-affinity binding to chromatin.
Belongs to the histone H1/H5 family.
References
Application: WB Species: Mice Sample: OSRC2 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.