MAPRE1 Antibody - #DF13549
| Product: | MAPRE1 Antibody |
| Catalog: | DF13549 |
| Description: | Rabbit polyclonal antibody to MAPRE1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Rabbit, Dog |
| Mol.Wt.: | 29kDa; 30kD(Calculated). |
| Uniprot: | Q15691 |
| RRID: | AB_2846568 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13549, RRID:AB_2846568.
Fold/Unfold
5530600P05Rik; Adenomatous polyposis coli binding protein EB 1; Adenomatous polyposis coli binding protein EB1; AI462499; AI504412; APC binding protein EB 1; APC binding protein EB1; APC-binding protein EB1; AW260097; BIM1p; D2Ertd459e; EB 1; EB1; End binding protein 1; End-binding protein 1; fa01e12; fc23e11; fi33c06; MAPRE 1; MAPRE1; Mapre3; MARE1_HUMAN; MGC117374; MGC129946; MGC52508; Microtubule associated protein RP/EB family member 1; Microtubule-associated protein RP/EB family member 1; wu:fa01e12; wu:fc23e11; wu:fi33c06; zgc:55428; zgc:77807; zgc:85755;
Immunogens
A synthesized peptide derived from human MAPRE1, corresponding to a region within the internal amino acids.
- Q15691 MARE1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes cytoplasmic microtubule nucleation and elongation. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. Also acts as a regulator of minus-end microtubule organization: interacts with the complex formed by AKAP9 and PDE4DIP, leading to recruit CAMSAP2 to the Golgi apparatus, thereby tethering non-centrosomal minus-end microtubules to the Golgi, an important step for polarized cell movement. Promotes elongation of CAMSAP2-decorated microtubule stretches on the minus-end of microtubules. Acts as a regulator of autophagosome transport via interaction with CAMSAP2. May play a role in cell migration (By similarity).
Cytoplasm>Cytoskeleton. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Golgi apparatus.
Note: Associated with the microtubule growing distal tips (PubMed:28814570). Recruitment to the Golgi apparatus requires the presence of PDE4DIP isoform 13/MMG8/SMYLE (PubMed:25217626).
Ubiquitously expressed.
Composed of two functionally independent domains. The N-terminal domain forms a hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.
Belongs to the MAPRE family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.